close all open/close all

CDS information : Azino_00030


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction7,205 / 6,384 / - [in whole cluster]
7,205 / 6,384 / - [in contig]
Locationcomplement(6384..7205) [in whole cluster]
complement(6384..7205) [in contig]
TypeCDS
Length822 bp (273 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)Azi2
GeneaziA6
Gene (GenBank)azi2
EC number
Keyword
Note
Note (GenBank)
  • thioesterase
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q846W2
NITE
Monen_00290
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)
ACC
Q9ZGI1
NITE
Pikro_00070
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[10421766] Elucidating the mechanism of chain termination switching in the picromycin/methymycin polyketide synthase. (Chem Biol. , 1999)
[10676969] Alternative modular polyketide synthase expression controls macrolactone structure. (Nature. , 2000)
[10713461] Genetic architecture of the polyketide synthases for methymycin and pikromycin series macrolides. (Gene. , 2000)
[11223265] The Streptomyces venezuelae pikAV gene contains a transcription unit essential for expression of enzymes involved in glycosylation of narbonolide and 10-deoxymethynolide. (Gene. , 2001)
[12368286] Biochemical evidence for an editing role of thioesterase II in the biosynthesis of the polyketide pikromycin. (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>putative type II thioesterase [Azi2]
MSTDTHAGASPRSGPVSFTMDSPWVRRVPREQARVRLICLPFAGGGASVYQRTAALMPSW
VETLTVQLPGREDRSREEPPARIETLVTACSIALRPYTTMPYVLYGHCAGGLLAYEIAHE
MGRRFGTWPQRLIVGEQPAPQAPPPAEPLHLLPDEELLATVRERGGLPDAVARNAPLLDM
LLPLLRSDFELWENYRHRPRPPLPVPITTVRGLTGSVDESDLAGWAAQTAVGRTGLSVEG
GHYFVVGLTPEAAREIGGQLAVEPPAPAGRTSS
selected fasta
>putative type II thioesterase [Azi2]
TTGAGCACGGACACCCACGCAGGGGCGTCCCCGCGCAGCGGACCGGTGAGCTTCACCATG
GACTCGCCCTGGGTGCGCCGCGTCCCCCGCGAACAGGCCCGGGTACGGCTGATCTGTCTG
CCGTTCGCCGGTGGCGGCGCGTCCGTGTACCAGCGGACGGCGGCACTCATGCCCTCCTGG
GTGGAGACGCTGACGGTGCAGCTGCCCGGCCGTGAGGACCGCTCCCGGGAGGAGCCGCCG
GCCCGCATCGAAACGCTGGTCACCGCCTGCTCGATCGCCCTGCGCCCGTACACCACCATG
CCGTACGTGCTGTACGGGCACTGTGCGGGCGGGTTGCTGGCGTACGAGATCGCGCACGAG
ATGGGCCGCCGGTTCGGAACGTGGCCGCAGCGGCTGATCGTCGGCGAGCAGCCCGCTCCG
CAGGCGCCGCCGCCTGCGGAGCCGTTGCACCTGCTCCCGGACGAGGAGCTGCTGGCGACG
GTGCGCGAGCGCGGCGGGCTGCCCGACGCGGTGGCCCGCAACGCGCCGTTGCTGGACATG
CTCCTGCCGCTGCTGCGCAGTGACTTCGAGCTCTGGGAGAACTACCGGCACCGGCCGCGT
CCCCCGCTGCCGGTTCCGATCACCACGGTTCGGGGGCTGACCGGCTCGGTGGACGAGTCG
GACCTGGCCGGCTGGGCCGCGCAGACGGCCGTGGGCCGGACCGGTCTGAGTGTGGAGGGC
GGGCACTACTTCGTCGTCGGACTCACCCCGGAGGCCGCCCGGGAGATCGGTGGACAGCTG
GCCGTCGAACCGCCCGCTCCGGCCGGAAGGACCTCTTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [36-256]  4.5e-36 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit