close all open/close all

CDS information : Azino_00040


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction10,513 / 7,202 / - [in whole cluster]
10,513 / 7,202 / - [in contig]
Locationcomplement(7202..10513) [in whole cluster]
complement(7202..10513) [in contig]
TypeCDS
Length3,312 bp (1,103 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)Azi3
GeneaziA4
Gene (GenBank)azi3
EC number
Keyword
Note
Note (GenBank)
  • NRPS(C-A-PCP)
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

B4 aziridino[1, 2a]pyrrolidinyl amino acid
C35..331
A515..908
PCP991..1062

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [Azi3]
MSQQSELLRRLRRLPGERRDALLAQLEDVSAGARSAPLSYRQEQLWLFDRFAPSSLAYGL
GFALPIEGRLDTEALGAALADLLQRHTVLRSTFSDEDTRGTQRLKPVPRIRLETEDVPAE
RLHPRADEVVQGELRRGFDLNSGPMVRFRLLRSAPDLHLLVLTSHSIVLDPRSARVLQGD
LAHAYRARAAGAAPAWAQDPVEFGTYAAWQRAWCEQDAAREATTYWRDALAGWESTELPT
DLPRPRLIDLSSDVVRRPLPPGLAAAADDLATGSGAERRDVLLAAFLVVIARHTSRGDLT
IGLPQDVAGPYDESRLVGDIGNLLPLRVELDEADSFAAVVARVRDARRDGLHHASLPFKL
ILDALGVEPDAGRLPLVQIGFTTPVAGGGPAEADGVRFGCEQIDAGSGAFELALEVTDGE
QPTVAVRFATSLYRRATATRVLDRFLQTLDALCRQPRRPLGDAPLGTPQEHADVRERWNE
PIGAPADTPLHDLFAEVVAAAPDNTALLWKGGSLSYGELDAWSWRIARRLTAAGVGLGDL
VPVVMQRGPALLAAVLGVLRAGGAYVPVDAGQPDERLAMILEDTGARTVVVSPGTADRVP
GPLALVVGADPLDGPQAEEEPPAVVVPAASAAYVIYTSGSTGRPKGVVVEHRNAANFTRT
VRDMFDLTPEDRVLHFASPGFDVSVFEIFGTLLSGAVLYVLDEDQRRSVDALDAVLQEQR
ITVIDLPPAIMDLLAPENYPDLRVAFVGGEAFTGELTTRWARGRSFWNGYGPTETTVTVV
AKRCEGEWTASPPIGRAMANHRAYVVDGAGASLLPAGAVGELAIAGLGVARGYLGQPALT
ADRFRPDPDGPPGSRRYLTGDLAVWDEAGDLCFVGRADRQVKVRGVRIELGEVEAALQAV
DGVAQAVAEVATDPRTGALLVAYVVPERPGELQLDTIRSAVARRLPAAMVPSVLVPLDAV
PLTPSGKIDRRRLPAVEFAVVDELSEADEENSTPTERTMREEVFTPLLGARIGNHVNFFA
AGGTSLQAIQLSSRVNAVFGVALPIADFFATPTVAGLAGLVDAARSGQEARRDALAEALD
LVEGSSDEELAELAASLDGEGTR
selected fasta
>non-ribosomal peptide synthetase [Azi3]
ATGAGTCAACAGAGCGAGCTGCTTCGCCGACTGCGCCGGCTCCCGGGGGAGCGCCGGGAC
GCGCTGTTGGCTCAGCTGGAGGATGTGTCCGCCGGAGCCCGGTCCGCCCCCCTGTCCTAC
CGGCAGGAGCAGCTGTGGCTGTTCGACCGGTTCGCCCCCAGCAGCCTGGCCTACGGGCTC
GGCTTCGCCCTCCCGATCGAGGGCCGGCTCGACACGGAAGCGCTGGGCGCGGCGCTGGCC
GATCTGCTGCAGCGCCACACCGTGCTGCGCTCGACGTTCTCCGACGAGGACACCCGGGGC
ACCCAGCGGCTGAAGCCGGTGCCCCGCATCCGTCTGGAGACCGAGGACGTTCCCGCCGAG
CGGTTGCACCCGCGCGCCGACGAGGTGGTGCAGGGCGAGCTGCGCCGGGGATTCGACCTC
AACTCCGGCCCGATGGTCCGTTTCCGGCTGCTGCGGTCCGCCCCCGACCTGCACCTGCTG
GTGCTGACCAGCCACTCCATCGTCCTCGACCCGCGCTCCGCACGCGTGCTGCAGGGCGAT
CTGGCCCACGCCTACCGCGCCCGGGCGGCGGGCGCAGCGCCGGCCTGGGCGCAGGATCCG
GTGGAGTTCGGTACCTACGCGGCCTGGCAGCGGGCCTGGTGCGAGCAGGACGCCGCCCGC
GAGGCGACCACCTACTGGCGTGACGCCCTCGCGGGCTGGGAGAGCACCGAGCTGCCCACC
GACCTCCCCCGTCCGCGGCTGATCGACCTGAGCAGCGACGTCGTCCGGCGGCCGCTGCCG
CCCGGACTGGCGGCGGCCGCCGACGACTTGGCGACCGGGAGCGGCGCCGAACGGCGGGAC
GTCCTGCTGGCCGCTTTCCTGGTCGTGATCGCCCGCCACACCTCCCGGGGCGACCTCACC
ATCGGACTTCCCCAGGACGTCGCGGGCCCGTACGACGAGAGCCGACTCGTCGGTGACATC
GGAAACCTGCTGCCGCTGCGGGTCGAACTGGACGAGGCGGACAGCTTCGCCGCCGTGGTG
GCCCGGGTGCGCGACGCCCGGCGGGACGGCCTGCACCACGCGAGTCTGCCGTTCAAGCTG
ATCCTGGACGCACTCGGGGTGGAGCCCGACGCCGGCCGGCTGCCCCTGGTACAGATCGGC
TTCACGACCCCGGTCGCGGGCGGCGGACCGGCCGAGGCCGACGGGGTGCGCTTCGGCTGC
GAGCAGATCGACGCCGGGTCCGGCGCGTTCGAACTCGCGCTGGAGGTCACGGACGGTGAA
CAGCCCACCGTGGCCGTGCGGTTCGCCACCTCTCTCTACCGGCGGGCCACGGCCACCCGC
GTCCTGGACCGTTTCCTGCAGACCCTGGACGCGCTCTGCCGACAGCCGCGGCGTCCCCTG
GGAGACGCCCCGCTGGGCACGCCGCAGGAGCACGCCGACGTACGGGAGCGCTGGAACGAG
CCGATCGGCGCGCCTGCCGACACCCCGCTGCACGACCTGTTCGCCGAGGTCGTCGCGGCG
GCTCCGGACAACACCGCGCTGCTGTGGAAGGGCGGCTCCCTGTCCTACGGCGAACTGGAC
GCCTGGTCCTGGCGGATCGCGCGGCGGCTGACGGCCGCCGGGGTGGGGCTCGGCGACCTC
GTGCCGGTGGTGATGCAGCGGGGCCCGGCCCTGCTCGCCGCCGTCCTCGGTGTCCTGCGG
GCCGGGGGCGCCTACGTGCCGGTGGACGCCGGCCAGCCCGACGAGCGGCTGGCGATGATC
CTGGAGGACACCGGGGCCAGGACCGTGGTGGTCTCCCCCGGTACGGCGGACCGGGTCCCC
GGTCCGCTGGCGCTGGTCGTCGGTGCCGATCCGCTGGACGGACCGCAGGCGGAGGAGGAG
CCGCCTGCGGTCGTCGTGCCGGCCGCCTCCGCGGCGTACGTCATCTACACCTCGGGGTCC
ACCGGCCGTCCCAAGGGGGTGGTGGTCGAGCACCGCAACGCGGCCAACTTCACCCGCACC
GTCCGGGACATGTTCGACCTCACTCCCGAGGACCGGGTCCTGCATTTCGCCTCCCCCGGC
TTCGACGTCTCGGTGTTCGAGATCTTCGGAACCCTGCTCAGCGGCGCGGTCCTGTACGTA
CTGGACGAGGACCAGCGGCGCTCCGTGGACGCCCTCGACGCAGTCCTGCAGGAGCAGCGG
ATCACCGTCATCGACCTGCCCCCGGCGATCATGGATCTGCTCGCTCCCGAGAACTATCCC
GACCTGCGGGTGGCGTTCGTCGGGGGCGAGGCGTTCACCGGCGAGCTGACCACGCGGTGG
GCCCGTGGCCGGAGCTTCTGGAACGGGTACGGCCCGACGGAGACCACGGTGACCGTGGTG
GCCAAGCGATGCGAGGGCGAGTGGACGGCCTCGCCGCCGATCGGCCGGGCGATGGCCAAT
CACCGTGCCTACGTGGTGGACGGCGCCGGTGCGTCGTTGCTCCCGGCCGGCGCGGTCGGT
GAACTCGCCATCGCCGGGCTGGGCGTGGCGCGCGGCTACCTGGGCCAGCCCGCCCTCACC
GCCGACCGGTTCCGGCCGGACCCCGACGGGCCTCCCGGTTCCCGCCGCTACCTCACCGGT
GACCTGGCCGTCTGGGACGAGGCAGGGGACCTGTGCTTCGTCGGCAGGGCCGACCGGCAG
GTGAAGGTCCGCGGCGTGCGGATCGAGCTGGGCGAGGTGGAGGCCGCGCTGCAGGCGGTG
GACGGAGTCGCCCAGGCGGTGGCGGAGGTGGCGACCGATCCGCGCACCGGCGCGCTGCTG
GTGGCGTACGTGGTGCCGGAGCGTCCCGGCGAGCTGCAGCTGGACACGATCCGCTCCGCG
GTGGCGCGCCGGCTGCCGGCCGCGATGGTCCCCTCCGTCCTGGTGCCGCTCGACGCGGTC
CCGCTGACCCCGAGCGGCAAGATCGACCGACGGCGGCTGCCCGCCGTGGAGTTCGCCGTG
GTGGACGAACTCTCCGAGGCCGACGAGGAGAACAGCACGCCCACCGAGCGCACGATGCGC
GAGGAGGTGTTCACCCCGCTGCTGGGCGCCCGGATCGGCAATCACGTGAACTTCTTCGCG
GCGGGCGGCACCAGTCTTCAGGCGATCCAGCTGTCCTCCCGCGTGAACGCCGTGTTCGGG
GTGGCCCTGCCGATCGCCGACTTCTTCGCCACTCCCACCGTGGCCGGTCTGGCCGGGCTC
GTCGACGCGGCGCGTTCGGGCCAGGAAGCGCGGCGGGACGCGCTGGCGGAGGCCCTGGAC
CTGGTGGAGGGGAGCAGCGACGAGGAACTCGCCGAGCTGGCCGCCTCGCTGGACGGGGAG
GGGACGCGTTGA
[4] C35..331
[4] A515..908
[4] aziridino[1, 2a]pyrrolidinyl amino acid682..777
[4] PCP991..1062
[4] C103..993
[4] A1543..2724
[4] aziridino[1, 2a]pyrrolidinyl amino acid2044..2331
[4] PCP2971..3186

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [515-907]  4.2e-103 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [35-331]  4.9e-44 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [988-1063]  1.49999977583352e-13 SSF47336
SSF47336   ACP_like
 [1008-1061]  2.8e-10 PF00550
PF00550   PP-binding
 [991-1062]  PS50075
PS50075   ACP_DOMAIN
 [986-1067]  1.2e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [515-908]  7.90000000000016e-127 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [634-645]  PS00455
PS00455   AMP_BINDING
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM No significant hit