close all open/close all

CDS information : Azino_00060


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction12,585 / 11,548 / - [in whole cluster]
12,585 / 11,548 / - [in contig]
Locationcomplement(11548..12585) [in whole cluster]
complement(11548..12585) [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Product3-hydroxy-5-methyl-naphthoic acid C-3 O-methyltransferase
Product (GenBank)Azi5
GeneaziB2
Gene (GenBank)azi5
EC number2.1.1.-
Keyword
  • 3-methoxy-5-methyl-naphthoic acid
Note
Note (GenBank)
  • O-methyltransferase
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
[20485749] Biosynthesis of 3-methoxy-5-methyl naphthoic acid and its incorporation into the antitumor antibiotic azinomycin B. (Mol Biosyst. , 2010)

close this sectionSequence

selected fasta
>3-hydroxy-5-methyl-naphthoic acid C-3 O-methyltransferase [Azi5]
MAAGSGSGTPPGTPPPTLLTDLATGLWKTQTLTAAIETGLFEALAAGDADAPETAQRLGI
GKRPAEILLTACTALGLLEQRDGRYRNTAVAAHYLVPGLPDYFGGYVQMVARYTAPGWLR
ATEAVRTDAPTKPVPDPDRNMFEEGNRPESFWEGLFTFSTLTARQLAASVDLSGVRRIMD
VGGGAGATLIELCRQHPHLSGTVVDLPHVCALAGERIAAAGMTGRIDTAAADFFADPLPS
GHDAVLLSMILHDWDESQNRKILASCLDALPSGGTVLISELLVDDDKSGPVDAALMSMNM
LVGTWGRNYTGAEYTDWLRDAGCSEVRTVRFASPGANGVVAGVKA
selected fasta
>3-hydroxy-5-methyl-naphthoic acid C-3 O-methyltransferase [Azi5]
ATGGCCGCCGGTTCCGGCTCCGGGACGCCTCCCGGCACCCCGCCTCCGACCCTGCTGACC
GACCTGGCGACGGGGCTGTGGAAGACCCAGACCCTGACCGCGGCGATCGAGACAGGCCTC
TTCGAAGCCCTGGCCGCCGGCGACGCCGACGCTCCCGAGACGGCGCAACGGCTCGGCATC
GGCAAGCGGCCGGCCGAGATCCTGCTGACCGCGTGCACCGCGCTCGGGCTGCTGGAGCAG
CGGGACGGGCGCTATCGGAACACCGCCGTCGCGGCGCACTACCTGGTGCCCGGCCTGCCC
GACTACTTCGGCGGTTACGTGCAGATGGTGGCCCGGTACACCGCGCCGGGGTGGCTTCGG
GCGACCGAGGCGGTACGCACCGACGCCCCCACCAAGCCGGTGCCCGACCCGGACCGGAAC
ATGTTCGAGGAGGGCAACCGGCCGGAGTCCTTCTGGGAGGGGCTCTTCACCTTCTCCACC
CTGACCGCCCGCCAGCTGGCGGCGTCGGTGGACCTCTCCGGTGTCCGCCGGATCATGGAC
GTCGGCGGCGGCGCGGGCGCCACGCTGATCGAACTGTGCCGGCAGCACCCGCACCTGAGC
GGCACCGTCGTCGACCTGCCGCACGTGTGCGCACTCGCCGGCGAACGCATCGCCGCGGCC
GGTATGACCGGACGCATCGACACGGCCGCGGCCGACTTCTTCGCGGATCCGCTGCCCTCC
GGGCACGACGCCGTCCTGCTGTCGATGATCCTGCACGACTGGGACGAGAGCCAGAACCGG
AAGATCCTCGCCTCCTGCCTGGACGCGCTGCCCTCCGGCGGCACCGTCCTGATCAGTGAG
CTGCTGGTGGACGACGACAAATCCGGCCCGGTGGACGCGGCGCTGATGAGCATGAACATG
CTGGTGGGCACCTGGGGACGGAACTACACCGGCGCCGAGTACACCGACTGGCTGCGCGAC
GCGGGCTGCTCCGAGGTGCGCACGGTCCGGTTCGCCTCACCGGGGGCGAACGGTGTGGTG
GCGGGGGTGAAGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [84-318]  6.80000000000006e-44 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [14-92]  1.1e-22 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [5-344]  3.39999972437719e-08 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit