close all open/close all

CDS information : Azino_00070


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction13,792 / 12,587 / - [in whole cluster]
13,792 / 12,587 / - [in contig]
Locationcomplement(12587..13792) [in whole cluster]
complement(12587..13792) [in contig]
TypeCDS
Length1,206 bp (401 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
5-methyl-naphthoic acid C-3 hydroxylase
Product (GenBank)Azi6
GeneaziB1
Gene (GenBank)azi6
EC number
Keyword
  • 3-methoxy-5-methyl-naphthoic acid
  • hydroxylate
Note
Note (GenBank)
  • cytochrome P450
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
[20485749] Biosynthesis of 3-methoxy-5-methyl naphthoic acid and its incorporation into the antitumor antibiotic azinomycin B. (Mol Biosyst. , 2010)

close this sectionSequence

selected fasta
>cytochrome P450 [Azi6]
MTTEAADATDRLVTAFDHHDPGYTPRTAERINTEIRERGVTWSPAYGGIWILSRYADVRA
ALTDWRTYSSARGVHFPRAEGMPMFSPIDYDPPAQRGIRERMAAPMTGDAVSAMVPELRR
MVARLLAPLAGRGHGDLMAEFAEPFAIEVLGVAFGLSESCRARIREATRTMWTYISADRD
ASKFWPAFHALLAEEVERVRDEPDGSYLARLAAMRRDGSPLPDEELYSIIVSFCVAGHDN
TMNSITRLVHTLAQDPALQLRLRREPELRPAVAEEALRRWCPTDRFTRVTTREVTVAGTV
IPAGARVVLLFDAANRDPEKFPDPDTFDPDRGNSHQHLSFGHGIHHCMGVHLARAEFAAV
LDELSRLPLFDLEQPSDLHFENGRHIMFDRVSVRFRTGEEH
selected fasta
>cytochrome P450 [Azi6]
ATGACCACCGAAGCCGCGGACGCCACCGACCGGCTGGTGACCGCTTTCGACCACCACGAC
CCCGGATACACCCCGCGGACCGCGGAGCGGATCAACACGGAGATCCGTGAGCGGGGGGTG
ACGTGGTCACCGGCGTACGGCGGCATCTGGATACTGTCCCGGTACGCGGACGTGCGCGCC
GCCCTGACGGACTGGCGTACCTACAGCTCGGCCCGCGGCGTGCACTTCCCGCGCGCCGAG
GGGATGCCGATGTTCTCACCCATCGACTACGACCCCCCGGCGCAGCGCGGGATACGTGAG
CGGATGGCCGCTCCGATGACGGGCGACGCCGTCTCCGCGATGGTGCCTGAGCTGCGCCGC
ATGGTCGCGCGGCTGCTCGCGCCGCTGGCCGGGCGCGGCCACGGGGACCTGATGGCCGAG
TTCGCGGAGCCGTTCGCCATCGAGGTGCTCGGAGTGGCCTTCGGGCTTTCCGAGAGCTGC
CGCGCCCGGATCCGCGAGGCGACGCGGACGATGTGGACCTACATCTCGGCCGACCGGGAC
GCGAGCAAGTTCTGGCCCGCCTTCCACGCCCTGCTGGCCGAGGAGGTCGAGCGGGTGCGC
GACGAGCCGGACGGCAGCTATCTCGCCCGGCTCGCGGCCATGCGGCGGGACGGTTCGCCG
TTGCCGGACGAGGAGCTGTACTCGATCATCGTCAGCTTCTGCGTCGCCGGGCACGACAAC
ACGATGAACTCGATCACCCGCCTCGTGCACACGCTGGCCCAGGATCCCGCACTCCAACTG
AGGCTGCGCCGCGAGCCGGAGCTGCGCCCGGCCGTCGCGGAGGAAGCCCTGCGCCGCTGG
TGTCCCACCGACCGGTTCACACGGGTCACCACCCGTGAGGTCACCGTCGCGGGCACCGTC
ATTCCGGCGGGTGCCCGGGTGGTGCTCCTGTTCGACGCTGCCAACCGGGACCCGGAGAAG
TTCCCGGATCCCGACACCTTCGATCCCGACCGCGGCAACTCCCATCAGCACCTCAGCTTC
GGGCACGGCATCCATCACTGCATGGGGGTGCACCTGGCCCGCGCCGAGTTCGCCGCCGTG
CTCGACGAACTGTCCCGGCTGCCGCTGTTCGACCTGGAGCAGCCGAGCGACCTGCATTTC
GAGAACGGTCGGCACATCATGTTCGACCGGGTGTCGGTGCGGTTCCGCACCGGAGAGGAG
CACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [179-362]  4.70000000000001e-22 PF00067
PF00067   p450
 [36-396]  2.20000000000002e-83 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [40-397]  6.59996953923913e-75 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [90-101]  2.49999811956465e-31 PR00359 [136-152]  2.49999811956465e-31 PR00359 [190-212]  2.49999811956465e-31 PR00359 [271-282]  2.49999811956465e-31 PR00359 [288-315]  2.49999811956465e-31 PR00359 [316-331]  2.49999811956465e-31 PR00359 [338-347]  2.49999811956465e-31 PR00359 [347-358]  2.49999811956465e-31 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [340-349]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit