close all open/close all

CDS information : Azino_00080


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction15,756 / 13,873 / - [in whole cluster]
15,756 / 13,873 / - [in contig]
Locationcomplement(13873..15756) [in whole cluster]
complement(13873..15756) [in contig]
TypeCDS
Length1,884 bp (627 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)Azi7
GeneaziA1
Gene (GenBank)azi7
EC number
Keyword
Note
Note (GenBank)
  • NRPS(A-PCP)
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
[20485749] Biosynthesis of 3-methoxy-5-methyl naphthoic acid and its incorporation into the antitumor antibiotic azinomycin B. (Mol Biosyst. , 2010)

close this sectionPKS/NRPS Module

B1 3-methoxy-5-methyl-naphthoic acid
A44..457
PCP540..607

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [Azi7]
MIRQQDAPAVPGAGPATTVVSRIELFARDTPDAPAVRHGERELTYRDLDRRAGQLASELV
ESGVRHGDMVAMYLGRSIEWVVGMLGCLKTGGVCMPLDPAVPAERFDRAVAAARPAAVVT
AVPGRGTGNPLPALPAGLPVVTLDASAPLPAETPGGGLAPRAQPRCEDLAYAMFTSGSSG
EAKIVLAQHSWLALSAARSAAVNATTAADRGSWLGAAGAGIALHEVGGLLWQGAQLVIGD
HEVIASPPALRDWLLAERITQSFVITPVGEVLQNLPWPRECALRLLTLGGDRLNRWGPAD
LPFEVAVSYGSLEAFQIANSCHPWSQRCTPATATDADRASAPPVGRPIAGVTVHLLEDDG
LTPVVDGIGEVWIDSDCLSLGYLGDPAQTADRFRPNPFGAAGSRIYRSGDAGRFRPDGIL
EHHGRIDNIVKIRGHRVELGDVEWALGQHPDVDQVAVVATWDGDQRRLVACFVAAREIAP
LELRDHAVERLPDWMVPVAYVQLDEFPLNTSRKIDRRRLPPADWSRGRPSRPWRAPAPGA
QTELARLFADLLQVDRVGADDHFVELGGDSLLLARLQSRIEQRFGVRIELPDLMAGPTVV
ELAGRIPGATAGRTGAAALPPIVPRRR
selected fasta
>non-ribosomal peptide synthetase [Azi7]
ATGATCCGCCAGCAGGACGCTCCGGCCGTACCCGGGGCCGGGCCGGCCACCACGGTGGTC
TCCCGTATCGAGCTGTTCGCCCGCGACACCCCCGATGCCCCCGCGGTCCGGCACGGCGAA
CGGGAGCTGACCTACCGGGACCTGGACCGGCGTGCCGGGCAACTCGCCTCGGAGCTGGTC
GAGTCGGGAGTACGACATGGCGACATGGTCGCCATGTACCTGGGCCGCTCCATCGAGTGG
GTGGTCGGCATGCTCGGCTGCCTGAAGACGGGCGGTGTGTGCATGCCGCTGGACCCGGCC
GTACCCGCGGAACGGTTCGACCGGGCGGTCGCCGCGGCGCGCCCCGCGGCCGTCGTGACC
GCGGTTCCCGGCCGTGGTACGGGCAACCCCCTGCCCGCACTCCCCGCCGGGCTGCCCGTG
GTCACCCTCGACGCGAGCGCTCCGCTCCCCGCAGAGACACCCGGCGGCGGACTCGCCCCG
CGTGCGCAACCACGGTGCGAGGACCTCGCGTACGCGATGTTCACCTCCGGTTCCTCCGGT
GAGGCCAAGATCGTGCTGGCCCAGCACTCCTGGCTGGCGCTCAGCGCCGCCCGCAGCGCC
GCGGTGAACGCCACCACCGCCGCCGACCGCGGTTCCTGGCTCGGCGCGGCCGGCGCCGGG
ATCGCGCTGCACGAGGTCGGCGGTCTGCTCTGGCAGGGGGCCCAGCTCGTGATCGGCGAC
CACGAGGTGATCGCGTCACCGCCCGCCCTGCGGGACTGGCTGCTCGCCGAGCGGATCACC
CAGAGTTTCGTGATCACCCCCGTCGGCGAGGTCCTGCAGAATCTGCCCTGGCCGCGCGAG
TGCGCGCTGCGGCTCCTCACCCTGGGCGGTGACCGGCTGAACCGGTGGGGGCCCGCGGAC
CTGCCGTTCGAGGTCGCCGTCTCCTACGGCAGCCTGGAAGCCTTCCAGATAGCCAACTCG
TGCCATCCCTGGTCCCAGAGGTGCACTCCCGCCACGGCCACCGACGCCGACCGCGCCAGC
GCCCCGCCTGTCGGCCGGCCGATCGCCGGGGTCACCGTCCACCTGCTGGAGGACGACGGC
CTGACACCGGTCGTCGACGGGATCGGCGAGGTGTGGATCGACTCGGACTGCCTCAGTCTC
GGGTATCTGGGCGATCCGGCGCAGACCGCGGACCGGTTCCGGCCCAACCCGTTCGGCGCC
GCGGGCAGCCGCATCTACCGCTCGGGCGACGCGGGCAGGTTCCGTCCCGACGGGATCCTG
GAGCACCACGGCCGGATCGACAACATCGTGAAGATACGCGGCCACCGGGTGGAGCTCGGG
GATGTCGAGTGGGCGCTCGGGCAGCACCCGGACGTCGACCAGGTCGCCGTGGTGGCGACC
TGGGACGGCGACCAGCGCCGCCTCGTCGCCTGCTTCGTCGCGGCACGCGAGATCGCGCCG
CTGGAGCTGCGCGACCACGCGGTGGAACGGCTGCCGGACTGGATGGTCCCGGTCGCGTAC
GTGCAACTGGACGAGTTCCCGCTGAACACGTCCCGCAAGATCGACCGCCGCAGGCTGCCC
CCGGCCGACTGGTCCCGGGGACGTCCGTCGCGCCCCTGGCGGGCACCCGCACCCGGAGCG
CAGACCGAGCTGGCCCGCCTGTTCGCGGATCTGCTGCAGGTGGACCGGGTCGGAGCCGAC
GACCACTTCGTGGAACTCGGCGGCGACTCCCTGCTGCTGGCCCGGTTGCAGAGCAGGATC
GAGCAGCGCTTCGGCGTCCGGATCGAACTGCCGGACCTGATGGCCGGCCCGACCGTCGTC
GAACTGGCCGGACGCATCCCGGGGGCCACCGCCGGGCGCACCGGCGCGGCCGCGCTGCCG
CCCATCGTGCCCCGGCGCCGCTGA
[1] A44..457
[1] 3-methoxy-5-methyl-naphthoic acid220..317
[1] PCP540..607
[1] A130..1371
[1] 3-methoxy-5-methyl-naphthoic acid658..951
[1] PCP1618..1821

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [44-457]  3.49999999999995e-75 PF00501
PF00501   AMP-binding
IPR009081 Acyl carrier protein-like (Domain)
 [532-624]  5.79999653854781e-17 SSF47336
SSF47336   ACP_like
 [540-607]  PS50075
PS50075   ACP_DOMAIN
 [543-606]  1.9e-15 PF00550
PF00550   PP-binding
 [531-608]  2.4e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
SignalP No significant hit
TMHMM No significant hit