close all open/close all

CDS information : Azino_00090


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction17,239 / 15,839 / - [in whole cluster]
17,239 / 15,839 / - [in contig]
Locationcomplement(15839..17239) [in whole cluster]
complement(15839..17239) [in contig]
TypeCDS
Length1,401 bp (466 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)Azi8
GeneaziE
Gene (GenBank)azi8
EC number
Keyword
Note
Note (GenBank)
  • putative transmembrane transport proteins
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q27YQ3
PmId
[19770276] The final step of hygromycin A biosynthesis, oxidation of C-5''-dihydrohygromycin A, is linked to a putative proton gradient-dependent efflux. (Antimicrob Agents Chemother. , 2009)
Family/Domain
FD
IPR011701

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [Azi8]
MTSTNSSSGTGTTPAASESAGAEVSPTSPPEPSGDTSAPTGGTSTKPRSVLFRNRDFALV
WGGESISLLGSEISVVALPLLAVITFGEGAFGVGMLIAAQWVPFVVLAPLMGVFTDRLNR
RMLMQLSNAVRFVVLGSLPLAWALGNLTMVHLYAAALVKGVFDVVFQLAYQAYLPQLLAR
EDLVDGNAKTQLSRSVALIFGRSGGGALVSALGAARAITVDAVSYLLAAIALGFVRFREP
EKQQTARGLSATLADLRGGITMTFGNRLLRYLTLMATFGNTAVSMVLAMIIVFGYDDLGL
SAAQVGLTLGVGGAPVVVGAILSRRINERLGIGRTLLMTHSMLVVAFALLPVSQAGGTGF
AVAVLIVSQGISSFTTPVGNVGVMTLIQKATPPQAMGRVGGVSLPLVWGANAVGPLLGSA
VAVTAGNSAAFYLASALALCAVLWILAGSVTRLTDDVPEDMRLVVG
selected fasta
>putative major facilitator superfamily transporter [Azi8]
ATGACCTCGACCAACTCGTCATCCGGGACGGGGACCACTCCGGCAGCGTCAGAAAGTGCC
GGGGCAGAGGTCTCGCCCACATCGCCGCCGGAACCGTCCGGCGACACGTCCGCCCCCACG
GGTGGCACGAGCACGAAGCCGCGCTCCGTCCTGTTCCGCAACCGCGACTTCGCTCTGGTC
TGGGGCGGCGAGTCGATCAGCCTGCTCGGCAGCGAGATCAGCGTGGTCGCGCTGCCGCTG
CTCGCCGTCATCACCTTCGGCGAGGGCGCGTTCGGGGTCGGCATGCTCATCGCCGCCCAA
TGGGTTCCGTTCGTCGTGCTCGCGCCGCTCATGGGGGTGTTCACCGACCGCCTGAACCGG
CGGATGCTGATGCAGCTGTCCAACGCGGTCCGCTTCGTCGTCCTCGGCTCACTGCCGCTG
GCCTGGGCGCTGGGCAACCTGACGATGGTCCACCTGTACGCGGCCGCGCTCGTCAAGGGC
GTCTTCGACGTCGTCTTCCAGCTCGCCTACCAGGCCTACCTTCCGCAGCTGCTGGCGCGC
GAGGACCTGGTGGACGGCAACGCCAAGACGCAGCTGAGCCGCTCGGTCGCCCTGATCTTC
GGACGCAGCGGTGGCGGCGCGCTGGTCAGCGCACTCGGCGCCGCGCGGGCGATCACCGTC
GACGCCGTCTCCTACCTGCTGGCGGCCATCGCGCTGGGTTTCGTACGGTTCCGTGAGCCC
GAGAAGCAGCAGACCGCGCGCGGTCTGAGCGCCACGCTGGCCGACCTGCGTGGTGGCATC
ACCATGACCTTCGGCAACAGACTGCTGCGGTATCTGACGCTGATGGCCACCTTCGGCAAC
ACCGCCGTGTCCATGGTCCTCGCGATGATCATCGTGTTCGGGTACGACGACCTGGGACTG
AGCGCGGCGCAGGTCGGGCTGACCCTCGGTGTCGGTGGCGCCCCGGTGGTGGTCGGCGCG
ATCCTGTCCCGCCGGATCAACGAGCGGCTGGGCATCGGCCGCACCCTGCTGATGACCCAC
TCGATGCTGGTGGTGGCGTTCGCCCTGCTGCCCGTGTCCCAGGCCGGCGGGACCGGGTTC
GCCGTGGCCGTGCTGATCGTCTCCCAGGGCATCTCGTCGTTCACCACACCCGTGGGGAAC
GTCGGGGTCATGACCCTCATCCAGAAGGCCACGCCGCCGCAGGCGATGGGCCGCGTCGGC
GGCGTCTCCCTGCCGCTCGTCTGGGGCGCCAACGCCGTCGGCCCGCTGCTGGGCAGTGCC
GTCGCCGTGACGGCCGGCAACAGCGCCGCCTTCTACCTGGCCTCCGCGCTCGCCCTGTGT
GCCGTGCTCTGGATCCTGGCCGGTTCGGTGACCCGGCTGACCGACGACGTACCGGAGGAC
ATGCGACTGGTCGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [65-404]  5.00000000000001e-23 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [45-459]  4.50001022902825e-40 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [268-466]  PS50850
PS50850   MFS
SignalP
 [1-22]  0.657 Signal
Bacteria, Gram-positive   
 [1-22]  0.945 Signal
Bacteria, Gram-negative   
TMHMM
 [65-87]  Transmembrane (i-o) [91-113]  Transmembrane (o-i) [133-155]  Transmembrane (i-o) [213-235]  Transmembrane (o-i) [269-291]  Transmembrane (i-o) [301-323]  Transmembrane (o-i) [330-352]  Transmembrane (i-o) [362-384]  Transmembrane (o-i) [404-426]  Transmembrane (i-o) [431-453]  Transmembrane (o-i)
Transmembrane 10