close all open/close all

CDS information : Azino_00100


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction17,541 / 20,888 / + [in whole cluster]
17,541 / 20,888 / + [in contig]
Location17541..20888 [in whole cluster]
17541..20888 [in contig]
TypeCDS
Length3,348 bp (1,115 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)Azi9
GeneaziA2
Gene (GenBank)azi9
EC number
Keyword
Note
Note (GenBank)
  • NRPS(C-PCP-C)
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

B2
3
C2..303
PCP551..622
C671..969

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [Azi9]
MPLAVIQEHFWSSDGSATEQAPLTECVALAVRGPLDAAALRTAVGALLSRHEILRSAVRL
HDGQPSQVVLPVPERLPLTITTLPSPDRDADARQARDRELSRFAATGIDPAAGCGIAFLL
LRDSDPAGEDTLALAVHHIFADATAVRLLLSELAADYDAALAGAPSPVPEPELQYGDFTQ
WEHASLLPAVQEPDTAWWRETLRDAPTALDVRPDRPRRRVRRGAGRRVGLVLRGVDGPAV
RNTARTLHASPYALCLAGWAAMITRSTGDTDLILGVLAANRTVPQLEPLVGQFANTVPLR
LDLAGAPDLADAVSRCSAAVAAAVEHGRLPFNRIVRAAAAPRPTDRPPLIQHMFMPRVDA
VGELTLGGQPVRTLDVERDRGRFDTVAEIDVTGDQVRLWLEYDSDLYTPDGIHALVDDYA
GVLRQWLARPALRLPELELSAPEPAGLALDDREPADGKPAEELRVDLPGGGAVTFLLDRS
PGPEYRPVLAGLRGARAEDLELRPGGSVHHPTDLLLAGVPTGLTARRDPRGRLEIVVETP
APVADARPGTGQDRLLDLVTEIWAQALEVPGLAPDDDFFTCGGHSLLATALVSEMQETLG
VRVRVRALFENPTPAELTAHLRETEPELDGMLELLAALPDTTPEKSADAPEQHDAHPATA
QPAGETAQTVDTPLLSGQRQLWLAQQADPDALTHTIPLILDLAGPLNPGAFAAALNDVVA
HQPGLRATFVEVDGLPVQRISPHTPVDVPVIDLTDHDDAAREAELRRLEQEIAYTGFDLT
RGPLLRARIILLGADRGQVQLLFHHLVTDEVSQTLLMQELSTAYRARTAGRAPVLPPHET
DLATLAKDEQDSLAGAEGERLRRFWVRELTGAAPLRLPTDRPRGDRAGFRGEFLERPASA
DAATTLRELAGVCRTTPFTVFCAAVAIVLRRLSGQSDIVIGIPTANRTQRGADRLIGCFL
NVVPVRLDLSGNPRFDELVQRVSEAVLRSYEHQQLPFAEIVQAVRPRRVPGTHPIYQVTC
ELQLESWMPARFADLDCDYRFVSHGTARYDMAFHGLLRPSGLSAMVELDTDLWDRATGYR
RIDQVLELLAVAARGPRTPIDDLPVTEREPRSLSR
selected fasta
>non-ribosomal peptide synthetase [Azi9]
ATGCCCCTAGCGGTCATCCAGGAGCACTTCTGGTCCTCGGACGGATCGGCAACGGAACAG
GCCCCGCTGACCGAGTGCGTGGCGCTGGCGGTGCGGGGCCCACTGGACGCGGCCGCTCTG
CGCACGGCGGTCGGCGCCCTGCTGTCCCGGCACGAGATCCTGCGCAGCGCGGTACGGCTG
CACGACGGACAGCCGAGCCAAGTGGTGCTCCCCGTGCCCGAGCGGCTGCCGTTGACGATC
ACCACTCTCCCCTCCCCGGACCGGGACGCGGACGCACGTCAGGCCCGGGACCGGGAACTG
TCCCGGTTCGCCGCGACCGGGATCGACCCCGCCGCCGGATGCGGGATCGCGTTCCTGCTG
CTGCGCGACAGCGACCCGGCGGGCGAGGACACCCTGGCCCTGGCCGTGCACCACATCTTC
GCGGACGCCACCGCGGTCCGGCTCCTGCTGTCGGAGCTGGCCGCCGACTACGACGCCGCG
CTCGCCGGGGCCCCCTCACCGGTACCCGAACCCGAACTCCAGTACGGCGACTTCACCCAG
TGGGAACATGCCTCGCTGCTCCCGGCCGTCCAGGAACCCGACACCGCGTGGTGGCGGGAG
ACCCTGCGTGACGCGCCCACCGCCCTGGACGTCAGACCGGACCGCCCGCGCCGCCGTGTC
CGCCGAGGCGCCGGCCGACGCGTCGGCCTCGTCCTGCGGGGAGTCGACGGACCCGCCGTG
CGGAACACCGCACGGACCCTGCACGCCTCGCCCTACGCCCTGTGCCTGGCGGGCTGGGCG
GCCATGATCACCCGCTCCACCGGTGACACGGACCTGATACTCGGCGTACTCGCGGCCAAC
CGGACCGTTCCCCAGCTGGAGCCGCTTGTCGGGCAGTTCGCCAACACCGTCCCGCTGCGG
CTGGACCTGGCGGGCGCACCGGACCTCGCCGACGCGGTGTCCCGCTGCTCGGCCGCGGTG
GCCGCCGCCGTCGAGCACGGCAGGCTGCCGTTCAACCGGATCGTGCGGGCCGCGGCCGCC
CCGCGCCCGACCGACCGGCCCCCGCTGATCCAGCACATGTTCATGCCGCGCGTGGACGCC
GTCGGCGAACTGACCCTGGGGGGACAGCCGGTACGGACCCTGGACGTCGAACGCGACCGC
GGCCGCTTCGACACCGTCGCCGAGATCGACGTCACCGGCGACCAGGTCCGGTTGTGGCTC
GAGTACGACAGCGACCTCTACACCCCGGACGGGATACACGCTCTGGTGGACGACTACGCG
GGGGTGCTGCGGCAGTGGCTGGCCCGGCCCGCGCTGCGCCTGCCGGAACTGGAACTGAGC
GCACCGGAGCCGGCCGGTCTCGCCTTGGACGACCGGGAGCCGGCCGACGGGAAGCCGGCG
GAGGAACTCCGGGTGGACCTGCCCGGCGGCGGAGCCGTCACGTTCCTGCTCGACCGCTCA
CCCGGACCCGAGTACCGGCCCGTCCTGGCCGGACTGCGCGGGGCCCGGGCGGAGGACCTG
GAGCTGCGGCCCGGAGGATCCGTGCATCACCCCACGGACCTGCTGCTCGCCGGGGTCCCC
ACCGGCCTCACGGCCCGGCGCGATCCACGGGGCCGGCTGGAGATCGTGGTGGAGACACCC
GCCCCGGTGGCGGACGCCCGTCCGGGCACGGGCCAGGACCGGCTCCTCGACCTCGTCACG
GAGATCTGGGCACAGGCACTCGAGGTGCCCGGACTCGCCCCGGACGACGACTTCTTCACC
TGCGGCGGGCACTCGCTGCTGGCCACCGCGCTGGTGAGCGAGATGCAGGAGACACTCGGC
GTCAGGGTACGGGTCCGCGCGCTGTTCGAGAATCCGACCCCGGCAGAGCTGACCGCCCAC
CTGCGGGAGACCGAACCCGAACTGGACGGCATGCTCGAACTCCTCGCCGCGCTGCCGGAC
ACCACGCCGGAGAAGAGCGCCGACGCGCCGGAGCAGCACGACGCGCACCCCGCCACCGCG
CAGCCGGCGGGAGAAACCGCGCAGACCGTGGACACACCTCTGCTGTCCGGCCAGCGTCAG
CTGTGGCTCGCCCAGCAGGCCGACCCGGACGCGCTCACCCACACCATCCCGCTCATCCTG
GACCTGGCCGGACCGCTGAACCCGGGGGCGTTCGCCGCGGCGCTGAACGACGTGGTCGCG
CACCAGCCGGGCCTGCGCGCCACGTTCGTCGAGGTCGACGGCCTGCCGGTGCAGCGGATC
AGTCCCCACACCCCGGTCGACGTCCCCGTGATCGACCTGACCGACCACGACGACGCCGCC
CGCGAAGCCGAACTGCGGCGCCTGGAACAGGAGATCGCCTACACCGGATTCGACCTCACC
CGCGGCCCGCTGCTGCGGGCCCGGATCATCCTGCTGGGGGCGGACCGCGGCCAGGTCCAG
CTCCTGTTCCACCACCTGGTCACCGACGAGGTGTCCCAGACCCTGCTGATGCAGGAGCTG
AGCACCGCCTACCGGGCCAGGACCGCCGGACGCGCTCCGGTCCTGCCGCCGCACGAGACC
GACCTCGCCACCCTGGCCAAGGACGAGCAGGACTCCCTCGCCGGCGCGGAGGGCGAACGC
CTGCGGCGGTTCTGGGTCCGTGAGCTGACCGGAGCGGCCCCGCTGCGCCTGCCCACCGAC
CGCCCGCGCGGCGACCGGGCCGGCTTCCGCGGCGAGTTCCTGGAACGACCGGCCTCCGCC
GACGCGGCCACCACTCTGCGTGAACTGGCCGGCGTCTGCCGCACGACCCCGTTCACCGTG
TTCTGCGCCGCCGTCGCGATCGTGCTGAGACGGCTGAGCGGCCAGAGCGACATCGTCATC
GGGATCCCCACCGCCAACCGCACGCAGCGGGGAGCCGACCGGCTGATCGGCTGCTTCCTC
AACGTCGTCCCGGTCCGGCTCGACCTGTCGGGCAACCCCCGCTTCGACGAACTCGTCCAG
CGGGTGAGCGAGGCCGTCCTGCGCTCCTACGAACACCAGCAGCTGCCCTTCGCGGAGATC
GTCCAGGCGGTCCGGCCCCGGCGAGTGCCCGGTACCCACCCCATCTACCAGGTCACCTGC
GAACTGCAGCTGGAGTCCTGGATGCCCGCCCGGTTCGCGGACCTGGACTGCGACTACCGC
TTCGTCTCCCACGGCACGGCCCGCTACGACATGGCCTTCCACGGGCTGCTGCGCCCCTCC
GGACTCTCGGCGATGGTGGAGCTCGACACCGACCTGTGGGACCGGGCGACCGGCTACCGG
CGGATCGACCAGGTGCTGGAGCTGCTCGCCGTGGCGGCGCGCGGCCCGCGGACCCCGATC
GACGACCTGCCCGTGACGGAGCGGGAGCCGCGGTCCCTCAGCCGGTGA
[2] C2..303
[2] PCP551..622
[3] C671..969
[2] C4..909
[2] PCP1651..1866
[3] C2011..2907

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001242 Condensation domain (Domain)
 [2-303]  1.29999999999998e-38 PF00668 [671-969]  2.19999999999997e-57 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [580-595]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [558-621]  3.2e-14 PF00550
PF00550   PP-binding
 [548-623]  4.60000044330862e-18 SSF47336
SSF47336   ACP_like
 [551-625]  2.3e-23 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [551-622]  PS50075
PS50075   ACP_DOMAIN
SignalP No significant hit
TMHMM No significant hit