close all open/close all

CDS information : Azino_00110


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction22,185 / 20,878 / - [in whole cluster]
22,185 / 20,878 / - [in contig]
Locationcomplement(20878..22185) [in whole cluster]
complement(20878..22185) [in contig]
TypeCDS
Length1,308 bp (435 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative sulfate adenylyltransferase subunit 1
putative ATP sulfurylase large subunit
Product (GenBank)Azi10
GeneaziH2
cysN
Gene (GenBank)azi10
EC number2.7.7.4
Keyword
Note
Note (GenBank)
  • sulfate adenylyltransferase subunit 1
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q10600
PmId
[15184554] The Mycobacterium tuberculosis cysD and cysNC genes form a stress-induced operon that encodes a tri-functional sulfate-activating complex. (Microbiology. , 2004)
ACC
P23845
PmId
[2828368] The sulfate activation locus of Escherichia coli K12: cloning, genetic, and enzymatic characterization. (J Biol Chem. , 1988)

close this sectionSequence

selected fasta
>putative sulfate adenylyltransferase subunit 1 [Azi10]
MSGSTGRWAGPSATALLRFATAGSVDDGKSTLVGRLLYDSKSVLTDQWEAVERASRHRGQ
DAPDLALLTDGLRAEREQGITIDVAYRYFATARRRFILADTPGHVQYTRNMVTGASTAEL
ALVLVDARHGVVEQTRRHATIAALLRVPHLVLAVNKMDLAGYEARVFARIAEEFTAYATE
LGVPEVTAIPISALVGDNVVEPSANMDWYGGPTVLEHLETVPVSHDLTGCHARLPVQYVI
RPRTAEHPDYRGYAGQIAAGAFRVGQEVTVLPSGATSRISGIDVLGEAVGEARAPQSVTL
LLEDDIDVARGDLLVPSGDGPVARRDVEATVCHVADAPLAVGQRVLLKHTTRTVRAIVAE
IRSRLVLDGIVAHPEPGQLVANDIGRVRIRTAEPLAVDAYADSRRTGSFLLIDPADGTTL
AAGMAGPAFGAAVTG
selected fasta
>putative sulfate adenylyltransferase subunit 1 [Azi10]
ATGAGTGGATCCACCGGACGGTGGGCCGGTCCGTCGGCCACCGCACTGCTGCGTTTCGCG
ACGGCCGGGTCGGTCGACGACGGCAAATCCACCCTCGTCGGCCGTCTTCTGTACGACTCC
AAGTCGGTCCTCACCGACCAGTGGGAGGCCGTCGAGCGCGCCTCCCGCCACCGCGGCCAG
GACGCCCCCGACCTGGCGCTGCTCACCGACGGCCTGCGCGCGGAGCGGGAGCAGGGCATC
ACCATCGACGTCGCCTACCGCTACTTCGCCACCGCCCGGCGCCGGTTCATCCTGGCGGAC
ACCCCCGGGCACGTGCAGTACACGCGGAACATGGTGACGGGCGCGTCCACGGCCGAGCTG
GCCCTCGTCCTCGTCGACGCCCGCCACGGCGTGGTCGAGCAGACCCGCAGGCACGCCACC
ATCGCCGCCCTGCTGCGCGTCCCGCACCTCGTCCTCGCCGTCAACAAGATGGACCTGGCG
GGCTACGAGGCGCGGGTGTTCGCCCGGATCGCCGAGGAGTTCACCGCGTACGCGACGGAG
CTGGGCGTCCCGGAGGTCACCGCGATCCCGATCTCCGCGCTCGTCGGCGACAACGTCGTG
GAACCGTCGGCGAACATGGACTGGTACGGCGGTCCCACCGTCCTGGAGCACCTGGAGACG
GTCCCGGTCAGCCACGACCTGACCGGCTGCCACGCCCGCCTCCCCGTCCAGTACGTGATC
AGGCCGCGGACCGCCGAGCACCCGGACTACCGCGGCTACGCGGGTCAGATCGCCGCCGGT
GCGTTCCGCGTCGGCCAGGAGGTCACGGTCCTGCCCTCCGGCGCCACCTCGCGCATCAGC
GGTATCGACGTGCTGGGCGAAGCGGTCGGCGAGGCGCGGGCGCCGCAGTCGGTGACGCTC
CTGCTGGAGGACGACATCGACGTCGCGCGCGGTGACCTCCTGGTGCCGTCAGGGGACGGC
CCGGTCGCCCGCCGGGACGTCGAGGCGACGGTCTGCCACGTCGCGGACGCGCCGCTCGCG
GTCGGGCAGCGGGTGCTCCTCAAACACACCACCCGTACCGTCAGAGCCATCGTCGCGGAG
ATCCGGTCCCGGCTCGTCCTGGACGGGATCGTCGCGCACCCGGAGCCCGGGCAGCTGGTC
GCCAATGACATCGGCCGGGTCCGGATCCGTACCGCGGAGCCGCTCGCCGTGGACGCCTAC
GCCGACTCGCGGCGCACCGGCTCCTTCCTGCTGATCGACCCGGCCGACGGGACGACGCTC
GCCGCGGGCATGGCGGGTCCCGCGTTCGGCGCGGCCGTCACCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000795 Protein synthesis factor, GTP-binding (Domain)
 [18-31]  3.7999986264479e-12 PR00315 [77-85]  3.7999986264479e-12 PR00315 [97-107]  3.7999986264479e-12 PR00315 [113-124]  3.7999986264479e-12 PR00315 [150-159]  3.7999986264479e-12 PR00315
PR00315   ELONGATNFCT
 [17-200]  4.9e-41 PF00009
PF00009   GTP_EFTU
 [70-85]  PS00301
PS00301   EFACTOR_GTP
IPR009000 Translation elongation/initiation factor/Ribosomal, beta-barrel (Domain)
 [226-322]  5.59999989417023e-18 SSF50447
SSF50447   Translat_factor
IPR009001 Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal (Domain)
 [322-427]  1.50000306971104e-25 SSF50465
SSF50465   Elong_init_C
IPR011779 Sulphate adenylyltransferase, large subunit (Family)
 [17-424]  TIGR02034
TIGR02034   CysN
SignalP
 [1-22]  0.919 Signal
Eukaryota   
TMHMM No significant hit