close all open/close all

CDS information : Azino_00120


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction23,021 / 22,185 / - [in whole cluster]
23,021 / 22,185 / - [in contig]
Locationcomplement(22185..23021) [in whole cluster]
complement(22185..23021) [in contig]
TypeCDS
Length837 bp (278 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative sulfate adenylyltransferase subunit 2
putative ATP sulfurylase small subunit
Product (GenBank)Azi11
GeneaziH1
cysD
Gene (GenBank)azi11
EC number2.7.7.4
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • sulfate adenylyltransferase subunit 2
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
P65670
PmId
[15184554] The Mycobacterium tuberculosis cysD and cysNC genes form a stress-induced operon that encodes a tri-functional sulfate-activating complex. (Microbiology. , 2004)
ACC
P21156
PmId
[2828368] The sulfate activation locus of Escherichia coli K12: cloning, genetic, and enzymatic characterization. (J Biol Chem. , 1988)

close this sectionSequence

selected fasta
>putative sulfate adenylyltransferase subunit 2 [Azi11]
MAGEFEKPVILFSGGKDSIVMLHLALKAFAPAPVPFSLLHVDTGHNFPEVLAYRDRAVAR
HGLRLHVASVQDYIDRGVLKERPDGTRNPLQTVPLTEKIHSERFDAVLGGGRRDEEKARA
KERVFSLRDEFSQWDPRRQRPELWQLYNGRHGPGEHVRVFPLSNWTELDVWQYIAREDIE
LPGIYYAHERPVFRRNGMWLTAGEWGGPKDGERVETRLVRYRTVGDMSCTGAVDSDAVTL
DQVVAEIATSRLTERGATRADDRLSEAAMEDRKREGYF
selected fasta
>putative sulfate adenylyltransferase subunit 2 [Azi11]
GTGGCGGGCGAGTTCGAGAAGCCGGTGATCCTGTTCTCCGGCGGCAAGGACTCGATCGTC
ATGCTGCACCTGGCGCTCAAGGCGTTCGCGCCCGCGCCGGTCCCCTTCTCGCTGCTGCAC
GTCGACACCGGGCACAACTTCCCCGAGGTCCTCGCCTACCGCGACCGCGCGGTGGCCCGC
CACGGACTGCGGCTGCACGTCGCCTCCGTGCAGGACTACATCGACCGCGGGGTGCTCAAG
GAGCGCCCGGACGGCACCCGCAACCCGCTGCAGACCGTGCCGCTCACGGAGAAGATCCAC
AGCGAGCGGTTCGACGCGGTCCTCGGCGGCGGGCGCCGCGACGAGGAGAAGGCCCGCGCC
AAGGAGCGCGTGTTCAGTCTCCGCGACGAGTTCTCGCAGTGGGACCCGCGCCGCCAGCGC
CCGGAACTGTGGCAGCTGTACAACGGGCGGCACGGCCCCGGCGAGCACGTCCGCGTCTTC
CCGCTGTCCAACTGGACCGAGCTGGACGTGTGGCAGTACATCGCCCGCGAGGACATCGAA
CTCCCCGGGATCTACTACGCCCACGAGCGCCCGGTGTTCCGCCGCAACGGCATGTGGCTG
ACCGCCGGCGAGTGGGGCGGCCCCAAGGACGGCGAACGCGTCGAGACCCGGCTGGTCCGC
TACCGCACGGTCGGCGACATGTCCTGCACCGGCGCCGTCGACTCCGACGCGGTGACGCTG
GACCAGGTCGTCGCCGAGATCGCCACGTCCCGGCTCACCGAGCGGGGCGCCACCCGGGCC
GACGACCGGCTGTCCGAGGCCGCGATGGAGGACCGCAAGCGTGAGGGGTACTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002500 Phosphoadenosine phosphosulphate reductase (Domain)
 [8-232]  3.5e-47 PF01507
PF01507   PAPS_reduct
IPR011784 Sulphate adenylyltransferase, small subunit (Family)
 [2-278]  5.9e-129 TIGR02039
TIGR02039   CysD: sulfate adenylyltransferase, small subunit
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [218-227]  1.4e-45 G3DSA:3.40.50.620
G3DSA:3.40.50.620   no description
SignalP No significant hit
TMHMM No significant hit