close all open/close all

CDS information : Azino_00130


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction23,658 / 23,101 / - [in whole cluster]
23,658 / 23,101 / - [in contig]
Locationcomplement(23101..23658) [in whole cluster]
complement(23101..23658) [in contig]
TypeCDS
Length558 bp (185 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative adenylyl-sulfate kinase
putative adenosine 5'-phosphosulfate kinase
putative APS kinase
Product (GenBank)Azi12
GeneaziH3
cysC
Gene (GenBank)azi12
EC number2.7.1.25
Keyword
Note
Note (GenBank)
  • putative adenylylsulfate kinase
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q10600
PmId
[15184554] The Mycobacterium tuberculosis cysD and cysNC genes form a stress-induced operon that encodes a tri-functional sulfate-activating complex. (Microbiology. , 2004)
ACC
P0A6J1
PmId
[2828368] The sulfate activation locus of Escherichia coli K12: cloning, genetic, and enzymatic characterization. (J Biol Chem. , 1988)
[1332767] Characterization of the phosphorylated enzyme intermediate formed in the adenosine 5'-phosphosulfate kinase reaction. (Biochemistry. , 1992)
[10860538] Mechanistic studies of Escherichia coli adenosine-5'-phosphosulfate kinase. (Arch Biochem Biophys. , 2000)

close this sectionSequence

selected fasta
>putative adenylyl-sulfate kinase [Azi12]
MIGPESCDCGVTVLLTGLPSAGKTTVAFLVAGRLRDAGHRVEVLDGDVMRKTLSAGLGFG
RADRHENLQRIGVMAEVLARNGVIVLVPVVAPYADSRDAVRQRHTASGTAFLEVHVATPV
EVCAQRDVKGLYARQRAGELTGLTGVDDPYQAPEKPDLVIPTVRQSADASASLLMDLLVR
KRFVA
selected fasta
>putative adenylyl-sulfate kinase [Azi12]
GTGATCGGGCCTGAATCATGTGACTGCGGCGTGACCGTCCTGCTGACGGGGCTGCCGAGT
GCGGGCAAGACGACGGTCGCGTTCCTGGTCGCCGGGCGACTGCGCGACGCGGGACACCGA
GTGGAGGTCCTGGACGGTGACGTCATGCGGAAGACACTGTCGGCAGGGCTCGGATTCGGC
CGGGCGGACCGGCACGAGAACCTGCAGCGGATCGGGGTGATGGCCGAGGTCCTCGCCCGC
AACGGCGTGATCGTCCTCGTGCCGGTGGTCGCGCCGTACGCCGACAGCCGCGACGCCGTC
CGGCAGCGGCACACCGCGAGCGGGACCGCATTCCTGGAAGTCCATGTGGCCACGCCCGTG
GAGGTCTGTGCGCAACGGGACGTCAAGGGCCTGTACGCCCGGCAGCGGGCCGGCGAGCTG
ACCGGTCTCACCGGGGTCGACGATCCCTACCAGGCGCCCGAGAAGCCCGACCTCGTCATC
CCGACGGTCCGGCAGTCGGCCGACGCGTCGGCCTCCCTGCTCATGGACCTGCTCGTGCGG
AAGCGGTTCGTGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002891 Adenylylsulphate kinase (Family)
 [10-165]  2.70000000000002e-56 PF01583
PF01583   APS_kinase
 [10-178]  2.4e-54 TIGR00455
TIGR00455   ApsK
SignalP No significant hit
TMHMM No significant hit