close all open/close all

CDS information : Azino_00140


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction23,726 / 24,127 / + [in whole cluster]
23,726 / 24,127 / + [in contig]
Location23726..24127 [in whole cluster]
23726..24127 [in contig]
TypeCDS
Length402 bp (133 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productthioesterase
Product (GenBank)Azi13
GeneaziG
Gene (GenBank)azi13
EC number
Keyword
  • 5-methyl-naphthoic acid
Note
  • This ORF acts as a chain elongation and cyclization (CEC) domain and is required for the additional two rounds of chain extension to form the 5-methyl naphthoate moiety.
Note (GenBank)
  • thioesterase superfamily protein
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
[26731610] Polyketide Ring Expansion Mediated by a Thioesterase, Chain Elongation and Cyclization Domain, in Azinomycin Biosynthesis: Characterization of AziB and AziG. (Biochemistry. , 2016)

close this sectionPKS/NRPS Module

A2
CEC1..133

close this sectionSequence

selected fasta
>thioesterase [Azi13]
MTTTDKTDSRLGPYVEHLGLQFERIDPDRAVAYWSVRADLLQPHGILHGGVHCAVVESVA
SAAADRWLGDRGTVVGVSNSTDFFAPATVADGRLTSTALPVHRGATQQVWSVETVDAAGR
LVARGQVRLHNLR
selected fasta
>thioesterase [Azi13]
ATGACGACAACTGACAAGACCGACAGCCGACTTGGGCCCTACGTCGAGCACCTGGGCCTG
CAGTTCGAGCGGATCGACCCGGACCGGGCGGTGGCGTACTGGTCGGTGCGCGCCGACCTG
CTGCAGCCTCACGGGATACTGCACGGCGGGGTGCACTGCGCTGTGGTCGAGTCCGTCGCC
AGCGCGGCAGCGGACCGCTGGCTGGGCGACCGGGGGACCGTGGTCGGGGTCAGCAACAGC
ACGGACTTCTTCGCTCCCGCGACCGTGGCCGACGGCCGTCTCACGTCGACGGCCCTGCCG
GTCCACCGCGGCGCCACCCAACAGGTCTGGTCGGTGGAGACGGTGGACGCGGCGGGCCGG
CTCGTCGCCCGTGGACAGGTCCGGCTGCACAACCTCCGCTGA
[2] CEC1..133
[2] CEC1..399

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003736 Phenylacetic acid degradation-related domain (Domain)
 [14-127]  4.6e-19 TIGR00369
TIGR00369   Unchar_dom_1
IPR006683 Thioesterase superfamily (Domain)
 [44-123]  8.3e-13 PF03061
PF03061   4HBT
SignalP
 [1-32]  0.084 Signal
Bacteria, Gram-positive   
TMHMM No significant hit