close all open/close all

CDS information : Azino_00150


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction24,516 / 24,328 / - [in whole cluster]
24,516 / 24,328 / - [in contig]
Locationcomplement(24328..24516) [in whole cluster]
complement(24328..24516) [in contig]
TypeCDS
Length189 bp (62 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)Azi14
GeneaziF
Gene (GenBank)azi14
EC number
Keyword
Note
Note (GenBank)
  • SimX2-like protein
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [Azi14]
MLRVERGHAEPEELAALTALLLVCAAARRQAGGGVPSRDHSPAGRRRPLRIPQFRAPHSW
QG
selected fasta
>hypothetical protein [Azi14]
TTGCTCCGGGTCGAGAGGGGACACGCGGAGCCCGAGGAACTCGCGGCTCTCACCGCCCTG
CTGCTGGTCTGCGCCGCGGCCCGGCGGCAGGCCGGGGGCGGTGTCCCCTCCCGGGACCAC
TCCCCCGCCGGCCGGCGGCGCCCGCTGCGCATTCCGCAGTTCCGGGCGCCGCACAGCTGG
CAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-26]  0.815 Signal
Eukaryota   
TMHMM No significant hit