close all open/close all

CDS information : Azino_00160


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction25,758 / 24,547 / - [in whole cluster]
25,758 / 24,547 / - [in contig]
Locationcomplement(24547..25758) [in whole cluster]
complement(24547..25758) [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative O-acyltransferase
Product (GenBank)Azi15
GeneaziD1
Gene (GenBank)azi15
EC number
Keyword
Note
Note (GenBank)
  • O-acyltransferase
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q9F838
NITE
Megalo_00040
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
ACC
Q00718
PmId
[1629172] A macrolide 3-O-acyltransferase gene from the midecamycin-producing species Streptomyces mycarofaciens. (J Bacteriol. , 1992)
ACC
Q56074
PmId
[8074537] Cloning of the macrolide antibiotic biosynthesis gene acyA, which encodes 3-O-acyltransferase, from Streptomyces thermotolerans and its use for direct fermentative production of a hybrid macrolide antibiotic. (Appl Environ Microbiol. , 1994)
ACC
P21542
PmId
[7764361] Cloning and nucleotide sequences of two genes involved in the 4''-O-acylation of macrolide antibiotics from Streptomyces thermotolerans. (Biosci Biotechnol Biochem. , 1993)

close this sectionSequence

selected fasta
>putative O-acyltransferase [Azi15]
MTIQRPAAAPQLSVATPDHRVHRLPSLTGLRFFAAFLVVISHVGTNLLPRVAPDQTFAIR
VLYECGAFGVSFFFILSGFVLTWVARDEDSVGRFWRRRFFKIYPNHLVTLLAALLLAAGA
GHALSGRDASTTLLLVQSWIPDMKLQYNLWSNTPTWSLACEVLFYLAFPWLLKLLRKIPP
ARLWVTFAVVYAAIWAVPLVASWMPTSGGVHPGTGQNWLSMWFMTFFPPVRMLEFVLGIV
TALIVVNRRWIRLPFAVSLVFPLIPLVAEGSMPDELGFVALTSLPLAFLVAAVASADING
RNGRTWLGSRPLVFLGEISFALYLVHWLVVAYGWIGRSSPAWGARPEPSTWPEILGLAGL
TIASSLVLAWLLYTLVERPVMRRWSRPRAARTEGVLTAAPERG
selected fasta
>putative O-acyltransferase [Azi15]
ATGACCATCCAGAGACCGGCGGCGGCACCACAGCTGTCCGTCGCCACGCCCGATCACCGG
GTCCACCGGCTTCCGTCCCTGACCGGGCTGCGGTTCTTCGCCGCGTTCCTGGTGGTGATC
TCGCACGTCGGGACCAACCTGCTGCCGCGGGTGGCTCCGGATCAGACGTTCGCGATCAGG
GTCCTGTACGAGTGCGGTGCCTTCGGGGTGTCGTTCTTCTTCATCCTGAGCGGGTTCGTG
CTGACCTGGGTCGCCCGGGACGAGGACTCCGTGGGGCGGTTCTGGCGGCGCCGCTTCTTC
AAGATCTATCCGAACCATCTGGTCACGCTGCTCGCCGCCCTTCTGCTCGCGGCGGGCGCG
GGCCATGCCCTGTCGGGACGCGACGCGAGCACGACACTGCTGCTGGTGCAGTCCTGGATC
CCGGACATGAAGCTCCAGTACAACCTGTGGTCGAACACTCCGACCTGGTCGCTCGCCTGC
GAAGTGCTCTTCTACCTGGCGTTCCCGTGGCTCCTGAAGCTGCTGCGGAAGATCCCGCCG
GCCCGCCTGTGGGTGACGTTCGCGGTGGTCTACGCGGCGATCTGGGCGGTGCCGCTGGTG
GCTTCCTGGATGCCGACGTCCGGGGGTGTCCACCCGGGCACCGGCCAGAACTGGCTCTCC
ATGTGGTTCATGACGTTCTTCCCGCCGGTGCGGATGCTGGAGTTCGTGCTGGGCATCGTG
ACGGCGCTGATCGTCGTCAACCGGCGGTGGATCCGGCTGCCGTTCGCCGTGTCGCTCGTG
TTCCCCCTGATTCCGCTCGTCGCCGAGGGCAGCATGCCCGACGAGCTCGGGTTCGTGGCG
CTCACGTCGCTGCCGCTCGCCTTCCTCGTCGCGGCCGTCGCCAGCGCCGACATCAACGGC
CGCAACGGCCGGACCTGGCTCGGCAGCAGGCCCCTGGTGTTCCTGGGCGAGATCTCCTTC
GCCCTCTACCTCGTGCACTGGCTGGTGGTGGCCTACGGCTGGATCGGCCGCAGCTCCCCC
GCCTGGGGGGCTCGGCCGGAGCCCTCGACATGGCCGGAGATCCTCGGCCTGGCGGGTCTG
ACCATCGCCTCCAGCCTGGTGCTGGCGTGGCTGCTGTACACGCTGGTGGAGCGGCCGGTC
ATGAGGCGGTGGAGCCGGCCCCGCGCGGCCCGGACCGAGGGCGTGCTCACCGCCGCCCCG
GAACGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002656 Acyltransferase 3 (Domain)
 [25-370]  1.69999999999999e-31 PF01757
PF01757   Acyl_transf_3
SignalP
 [1-45]  0.405 Signal
Eukaryota   
TMHMM
 [27-49]  Transmembrane (i-o) [59-81]  Transmembrane (o-i) [102-124]  Transmembrane (i-o) [153-175]  Transmembrane (o-i) [182-204]  Transmembrane (i-o) [224-246]  Transmembrane (o-i) [251-268]  Transmembrane (i-o) [278-300]  Transmembrane (o-i) [312-334]  Transmembrane (i-o) [354-376]  Transmembrane (o-i)
Transmembrane 10