close all open/close all

CDS information : Azino_00170


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction26,018 / 25,755 / - [in whole cluster]
26,018 / 25,755 / - [in contig]
Locationcomplement(25755..26018) [in whole cluster]
complement(25755..26018) [in contig]
TypeCDS
Length264 bp (87 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl carrier protein
Product (GenBank)Azi16
GeneaziC11
Gene (GenBank)azi16
EC number
Keyword
Note
Note (GenBank)
  • ACP/PCP
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Family/Domain
FD
IPR009081

close this sectionSequence

selected fasta
>putative acyl carrier protein [Azi16]
MASPGLVHDEDRIRYVQSVFRRVLRLEQDAAPDDDFFVLGGTSLAAMEVIDLIERERGLR
IPVRNFYRSTVVRALALELDPSRREAP
selected fasta
>putative acyl carrier protein [Azi16]
ATGGCGAGCCCTGGGCTGGTCCACGACGAAGACCGCATCCGTTACGTGCAGAGCGTGTTC
CGACGCGTACTCCGTCTGGAACAGGACGCGGCCCCCGACGACGACTTCTTCGTGCTCGGC
GGAACCTCGCTGGCCGCCATGGAAGTGATCGACCTGATCGAGCGGGAACGGGGGCTGCGC
ATCCCCGTACGGAACTTCTACCGCTCCACCGTGGTGCGCGCGCTGGCCCTCGAGCTCGAC
CCGTCCCGCAGGGAGGCCCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [5-81]  7.30000590915208e-12 SSF47336
SSF47336   ACP_like
 [13-81]  6.90000000000001e-15 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [12-80]  PS50075
PS50075   ACP_DOMAIN
 [15-77]  2e-12 PF00550
PF00550   PP-binding
SignalP No significant hit
TMHMM No significant hit