close all open/close all

CDS information : Azino_00180


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction27,043 / 26,021 / - [in whole cluster]
27,043 / 26,021 / - [in contig]
Locationcomplement(26021..27043) [in whole cluster]
complement(26021..27043) [in contig]
TypeCDS
Length1,023 bp (340 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative transketolase(fragment)
Product (GenBank)Azi17
GeneaziC6
Gene (GenBank)azi17
EC number
Keyword
  • aziridino[1,2a]pyrrolidinyl amino acid
Note
Note (GenBank)
  • transketolase C-terminal subunit
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
P33570
PmId
[8396116] Identification and characterization of the tktB gene encoding a second transketolase in Escherichia coli K-12. (J Bacteriol. , 1993)
ACC
O06811
PmId
[22645655] Structure and function of the transketolase from Mycobacterium tuberculosis and comparison with the human enzyme. (Open Biol. , 2012)
Family/Domain
FD
IPR005475, IPR005476

close this sectionSequence

selected fasta
>putative transketolase(fragment) [Azi17]
MTTARPAEQTPQPVLGPDPRAAYREALLELAAADSRVVCLDSDTGGLENTFGERFPDRYV
NVGIAEANLMTVAAGLARRGFLPYVHTMATFATMRAGEFLKLDVVGNRLPVRVVATHGGL
SAAHFGTSHFALEDLAVTRALSDLTVVVPGDARQIGPAMRQLHEVPGPAYLRLGRSATPV
PPGPAPAFRLGRARVLREGADVTLVAAGPLPLLLSLEAAAELAADGTEAQVLDLHTLHPL
DHEGLLAACRGRAGVVTVEEHRPQGGLGDAVTEVVAAELALPVRRVAVRGRPGVRVAGQR
AALEQLGVSTGAVADAARHLHAARAESPAQHTAAGPTMRG
selected fasta
>putative transketolase(fragment) [Azi17]
GTGACGACGGCGCGCCCCGCCGAGCAGACCCCGCAGCCGGTCCTCGGCCCGGATCCCCGG
GCCGCGTACCGCGAGGCGCTGCTGGAACTGGCCGCCGCCGACAGCCGCGTGGTCTGTCTC
GACTCCGACACCGGCGGCCTGGAGAACACCTTCGGCGAGCGCTTCCCGGACCGGTACGTC
AATGTCGGGATCGCGGAGGCGAACCTGATGACGGTGGCCGCCGGACTCGCCCGCCGCGGA
TTCCTTCCCTACGTGCACACGATGGCCACCTTCGCCACGATGCGCGCGGGCGAGTTCCTC
AAGCTGGACGTCGTGGGAAACCGGCTACCCGTACGGGTGGTGGCCACCCACGGCGGTCTC
TCCGCCGCCCACTTCGGCACCAGCCACTTCGCGCTGGAGGACCTCGCGGTGACCCGCGCC
CTGTCCGACCTGACCGTCGTCGTACCCGGTGACGCACGCCAGATCGGCCCTGCCATGCGC
CAGTTGCACGAGGTGCCCGGTCCCGCCTACCTGCGGCTGGGCCGCTCGGCCACCCCCGTG
CCGCCGGGGCCTGCCCCCGCCTTCCGGCTGGGCCGCGCCCGGGTCCTGCGCGAGGGCGCC
GACGTCACGCTGGTGGCCGCGGGACCGCTGCCCCTGCTCCTCTCGCTGGAGGCCGCGGCA
GAACTGGCTGCCGACGGCACCGAGGCGCAGGTCCTGGACCTGCACACCCTGCACCCGTTG
GACCACGAGGGCCTGTTGGCGGCGTGCCGGGGCCGCGCCGGAGTGGTGACGGTGGAGGAG
CACCGGCCGCAAGGCGGGCTGGGCGACGCGGTCACCGAGGTGGTCGCCGCCGAACTGGCT
CTCCCGGTGCGCCGCGTGGCCGTACGAGGCCGTCCCGGCGTGCGCGTCGCCGGCCAGCGG
GCCGCGCTGGAGCAGCTCGGCGTGAGCACCGGCGCGGTGGCGGACGCGGCCCGGCACCTG
CACGCAGCACGAGCCGAATCACCGGCGCAGCACACTGCCGCCGGCCCAACCATGAGGGGA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005475 Transketolase-like, pyrimidine-binding domain (Domain)
 [17-180]  4.90001027782408e-33 SM00861
SM00861   Transket_pyr
 [18-179]  4.29999999999999e-25 PF02779
PF02779   Transket_pyr
IPR005476 Transketolase, C-terminal (Domain)
 [191-292]  1.99999999999999e-19 PF02780
PF02780   Transketolase_C
IPR009014 Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II (Domain)
 [187-323]  1.79999754022375e-24 SSF52922
SSF52922   Transketo_C_like
IPR015941 Transketolase-like, C-terminal (Domain)
 [191-320]  1.99999999999999e-27 G3DSA:3.40.50.920
G3DSA:3.40.50.920   Transketo_C_like
SignalP
 [1-33]  0.112 Signal
Bacteria, Gram-positive   
TMHMM No significant hit