close all open/close all

CDS information : Azino_00190


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction27,975 / 27,040 / - [in whole cluster]
27,975 / 27,040 / - [in contig]
Locationcomplement(27040..27975) [in whole cluster]
complement(27040..27975) [in contig]
TypeCDS
Length936 bp (311 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative transketolase(fragment)
Product (GenBank)Azi18
GeneaziC5
Gene (GenBank)azi18
EC number
Keyword
  • aziridino[1,2a]pyrrolidinyl amino acid
Note
Note (GenBank)
  • transketolase N-terminal subunit
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
P27302
PmId
[8396116] Identification and characterization of the tktB gene encoding a second transketolase in Escherichia coli K-12. (J Bacteriol. , 1993)
[7607225] Transketolase A of Escherichia coli K12. Purification and properties of the enzyme from recombinant strains. (Eur J Biochem. , 1995)
ACC
P33570
PmId
[8396116] Identification and characterization of the tktB gene encoding a second transketolase in Escherichia coli K-12. (J Bacteriol. , 1993)
ACC
O06811
PmId
[22645655] Structure and function of the transketolase from Mycobacterium tuberculosis and comparison with the human enzyme. (Open Biol. , 2012)

close this sectionSequence

selected fasta
>putative transketolase(fragment) [Azi18]
MSRPPLPRRFLRSTSWSTSRTDARPKGIRTMAVPLTGPPQPPAPAPPPQPLDPADMARRI
RQDVIRMAGGPEGAHVGGSLSCADVLAVLHTRLLRPGDSFVLSKGHAAPALYSTLVQLGR
LPADELDSYTAPGSRLFGHPSHDLPGVEFATGSLGHGLGLSVGLAIAEQLHGGDGRVYTL
LGDGELQEGSVWEAALLAGHRRPPGLVAVVDRNGLQITGGTEDCVGLEPLDAKFAAFGWE
TRTVDGHDLPALYEALQPSPGGPVAVLARTVKGRGVPFLEARVAGHYAKLKPALVSRALA
ALGHPVQGGTA
selected fasta
>putative transketolase(fragment) [Azi18]
GTGAGCCGCCCGCCGCTCCCCCGCCGGTTCCTCCGCTCCACGTCCTGGTCCACGTCCCGG
ACCGACGCCCGTCCGAAGGGAATCCGCACGATGGCCGTACCCCTCACCGGCCCACCGCAG
CCACCCGCCCCCGCGCCGCCTCCGCAGCCGCTCGACCCGGCGGACATGGCCCGGCGGATC
CGCCAGGACGTGATCCGCATGGCGGGCGGGCCCGAGGGCGCGCACGTCGGCGGCAGTCTG
TCGTGCGCGGACGTCCTGGCCGTCCTGCACACCCGGCTCCTGCGTCCGGGCGACTCGTTC
GTGCTGAGCAAGGGGCACGCCGCACCCGCGCTGTACAGCACGCTGGTCCAGCTCGGAAGG
CTCCCGGCGGACGAGCTCGACAGCTACACCGCGCCGGGCAGCCGGCTGTTCGGCCACCCC
TCGCACGACCTGCCCGGAGTCGAGTTCGCCACCGGTTCCCTGGGCCACGGACTCGGCCTG
TCGGTGGGCCTGGCCATCGCCGAGCAGCTGCACGGCGGCGACGGACGCGTGTACACCCTG
CTCGGAGACGGTGAACTGCAGGAGGGCAGTGTCTGGGAGGCCGCCCTGCTCGCCGGTCAC
CGCAGGCCGCCCGGGCTGGTCGCGGTGGTGGACCGCAACGGGCTGCAGATCACGGGCGGT
ACGGAGGACTGCGTCGGACTCGAACCGCTGGACGCCAAGTTCGCGGCGTTCGGCTGGGAG
ACACGCACCGTCGACGGACACGACCTGCCCGCGCTGTACGAGGCCCTGCAGCCGTCCCCG
GGCGGTCCGGTCGCGGTGCTCGCGCGCACCGTGAAGGGCCGCGGGGTGCCGTTCCTCGAG
GCCCGCGTGGCCGGTCACTACGCCAAGCTCAAACCGGCCCTGGTCAGCAGGGCCCTGGCC
GCGCTCGGCCACCCCGTGCAGGGAGGTACGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005474 Transketolase, N-terminal (Domain)
 [56-303]  3.7e-41 PF00456
PF00456   Transketolase_N
SignalP
 [1-23]  0.447 Signal
Bacteria, Gram-negative   
 [1-25]  0.492 Signal
Bacteria, Gram-positive   
TMHMM No significant hit