close all open/close all

CDS information : Azino_00200


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction29,294 / 27,972 / - [in whole cluster]
29,294 / 27,972 / - [in contig]
Locationcomplement(27972..29294) [in whole cluster]
complement(27972..29294) [in contig]
TypeCDS
Length1,323 bp (440 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative aminotransferase
Product (GenBank)Azi19
GeneaziC7
Gene (GenBank)azi19
EC number2.6.1.-
Keyword
  • aziridino[1,2a]pyrrolidinyl amino acid
Note
Note (GenBank)
  • putative N-methyl-L-glucosamine biosynthetic aminotransferase
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q9F837
NITE
Megalo_00050
PmId
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>putative aminotransferase [Azi19]
MPELAHATTRLALLGGDRAVPKDSVGGTWPLVTTADEQAVLRVLREGPLNAASPGEREVG
GLERAWAQATGTRHCVAVASGTAALHLALRGCGIGPGDEVIVPALTMNATAHAVCAAGAT
PVFADVDPDTYTLDPRSAAAVCGPRTAALLPVHLHGLPADMRALDELAGRRGVPVVEDAA
QAHGAQLDGRRVGALGKAGCFSLHPHKNLPSCGEGGLITTDDDSLHEQLVRLRNFGELEP
TGARSYIAHRAALNARITPMAAAFTRSQLARFDDYARRREPGIRRFLNRLAQLPGLRVPQ
VPAGRTHAWHILRLMPDPEAFGLGPEHRCALRAALHRILRAEGVPVSRYQVAPLAAQPAF
RPPGASPADAADQVDALLPVTVAVVDGSLCLQRRHLDPAAGPLLQSYADAFEKVWQNLEL
VRRMATSRSAPGWREALRQG
selected fasta
>putative aminotransferase [Azi19]
ATGCCCGAGCTCGCCCACGCCACGACCCGCCTGGCCCTGCTCGGCGGAGACCGGGCCGTA
CCGAAGGACAGCGTGGGCGGCACCTGGCCGCTGGTCACCACCGCCGACGAACAGGCCGTG
CTGCGGGTGTTGCGCGAGGGCCCGCTGAACGCCGCCTCCCCCGGAGAACGCGAGGTCGGC
GGCCTGGAACGGGCCTGGGCGCAGGCCACCGGGACCCGGCACTGTGTCGCTGTCGCCTCC
GGCACCGCCGCACTGCATCTGGCCCTGCGCGGCTGCGGGATCGGTCCGGGCGACGAGGTG
ATCGTCCCGGCACTGACCATGAACGCGACCGCCCACGCGGTGTGCGCGGCAGGCGCCACA
CCCGTGTTCGCCGACGTGGATCCCGACACGTACACACTCGACCCGCGGTCCGCCGCAGCG
GTCTGCGGACCGCGAACCGCCGCGCTCCTGCCGGTACATCTGCACGGACTGCCGGCCGAC
ATGCGGGCGCTGGACGAACTGGCCGGCCGACGGGGCGTCCCCGTCGTGGAGGACGCGGCC
CAGGCACACGGCGCGCAGCTCGACGGGCGCCGGGTCGGCGCCCTCGGCAAGGCGGGCTGC
TTCAGCCTGCATCCCCACAAGAACCTGCCGAGCTGTGGTGAGGGGGGACTGATCACCACC
GACGACGACAGCCTGCACGAACAGCTGGTACGGCTGCGCAACTTCGGCGAGCTGGAACCC
ACCGGGGCTCGCAGCTACATCGCCCACCGGGCCGCCCTCAACGCCCGGATCACACCGATG
GCAGCCGCGTTCACCCGCTCCCAGCTGGCCCGCTTCGACGACTACGCCCGCCGCCGCGAG
CCGGGAATCCGCCGGTTCCTGAACCGGCTGGCTCAGCTGCCCGGACTGCGGGTGCCACAG
GTCCCGGCCGGACGCACCCACGCCTGGCACATCCTGCGGCTGATGCCGGACCCGGAGGCG
TTCGGCCTCGGGCCCGAGCACCGCTGCGCCCTGCGCGCCGCCCTGCACCGGATCCTGCGG
GCCGAGGGGGTGCCCGTCTCCCGGTACCAGGTCGCTCCGCTCGCGGCGCAGCCCGCGTTC
CGTCCCCCGGGTGCGTCCCCGGCGGACGCCGCGGACCAGGTGGACGCCCTCCTCCCGGTG
ACCGTCGCCGTCGTCGACGGATCGCTGTGCCTGCAGCGCCGGCACCTCGATCCGGCCGCC
GGGCCCCTGCTGCAGTCGTACGCCGACGCGTTCGAGAAGGTCTGGCAGAACCTCGAACTC
GTCCGCCGGATGGCCACCTCCCGCTCCGCTCCCGGCTGGCGGGAGGCGCTGCGCCAGGGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [33-369]  2.30000000000004e-92 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-412]  1e-72 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [28-270]  7.90000000000016e-70 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [273-369]  3.5e-10 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [22-385]  5.10003242202156e-82 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit