close all open/close all

CDS information : Azino_00205


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction29,496 / 29,675 / + [in whole cluster]
29,496 / 29,675 / + [in contig]
Location29496..29675 [in whole cluster]
29496..29675 [in contig]
TypeCDS
Length180 bp (59 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative glutamate/alpha-aminoadipate carrier protein LysW
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
  • aziridino[1,2a]pyrrolidinyl amino acid
Note
  • This ORF was originally created by DoBISCUIT based on description in following publication. Ref. PMID: 19620981
Note (GenBank)
Reference
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q9ZND7
PmId
[19620981] Discovery of proteinaceous N-modification in lysine biosynthesis of Thermus thermophilus. (Nat Chem Biol. , 2009)
ACC
Q4JAQ0
PmId
[23434852] Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus. (Nat Chem Biol. , 2013)

close this sectionSequence

selected fasta
>putative glutamate/alpha-aminoadipate carrier protein LysW
MTTALSVPCPECAGTLEVRPDVLAAEIVVCGQCSSELEVVATGPVVLALAPEVEEDWGE
selected fasta
>putative glutamate/alpha-aminoadipate carrier protein LysW
ATGACTACGGCGCTGAGCGTGCCGTGTCCCGAGTGCGCCGGGACGCTGGAGGTACGCCCT
GATGTGCTCGCCGCCGAGATCGTGGTCTGCGGACAGTGTTCGAGCGAGCTCGAGGTCGTG
GCGACCGGGCCCGTGGTGCTGGCCCTCGCTCCGGAGGTCGAAGAGGACTGGGGCGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit