close all open/close all

CDS information : Azino_00210


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction29,678 / 30,658 / + [in whole cluster]
29,678 / 30,658 / + [in contig]
Location29678..30658 [in whole cluster]
29678..30658 [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative LysW-glutamyl-phosphate/LysW-aminoadipyl-phosphate reductase
Product (GenBank)Azi21
GeneaziC4
Gene (GenBank)azi21
EC number
Keyword
  • aziridino[1,2a]pyrrolidinyl amino acid
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • N-acetyl-gamma-glutamyl-phosphate reductase
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
O50146
PmId
[19620981] Discovery of proteinaceous N-modification in lysine biosynthesis of Thermus thermophilus. (Nat Chem Biol. , 2009)
Family/Domain
FD
IPR000706

close this sectionSequence

selected fasta
>putative LysW-glutamyl-phosphate/LysW-aminoadipyl-phosphate reductase [Azi21]
MKVSVVGAAGYTGGELLRLVHAHPKLELAQALSRRHAGRPVAEVHPNLHHLALAFRSPEE
LEPVDAAFLALPSGASAEVETAVTGRATTIVDLSPDFRGGRPSADGTAYRTGLPELFAGE
LVGATRISVPGCMATAAVLALAPVQRSGLVAGDVVVDARAGSSGSGAEPSPASHHAERGN
AFRVYKPAGHRHEKEIAALAGVRARMTVTAVPTVRGAQVLCHVTPPRPVTRREVLHVLQR
AYRDHPFVRIVSRGRGVHRMPDPQFLGGTNFVDIGCAVDEDGGRIVLVAALDNLVKGAAG
GGVQSLNVAAGMPQDAGLEFTGLHPA
selected fasta
>putative LysW-glutamyl-phosphate/LysW-aminoadipyl-phosphate reductase [Azi21]
GTGAAGGTGAGCGTCGTCGGCGCGGCCGGATACACCGGAGGTGAACTGCTGCGGCTGGTG
CATGCCCACCCCAAGCTGGAACTGGCACAGGCGCTTTCGCGGCGGCATGCGGGCCGGCCG
GTGGCAGAGGTGCACCCCAACCTGCATCATCTCGCCCTGGCCTTCCGGTCCCCCGAGGAG
CTGGAGCCGGTGGACGCGGCGTTCCTGGCCCTGCCCTCCGGCGCCTCCGCCGAGGTGGAG
ACAGCGGTGACGGGCCGGGCCACGACCATCGTGGACCTGAGCCCCGATTTCCGGGGCGGC
CGGCCCTCGGCGGACGGCACCGCCTACCGGACCGGCCTGCCCGAGCTGTTCGCCGGCGAA
CTCGTCGGCGCCACCCGGATCAGCGTGCCCGGATGCATGGCCACCGCGGCCGTCCTGGCC
CTGGCTCCGGTCCAGCGCAGTGGTCTGGTGGCCGGCGACGTGGTGGTGGACGCCCGGGCC
GGGTCGTCGGGCTCCGGAGCGGAGCCGAGCCCTGCCTCGCACCACGCGGAGCGCGGCAAC
GCCTTCCGGGTCTACAAGCCCGCGGGACACCGGCACGAGAAGGAGATCGCCGCACTGGCC
GGGGTGCGTGCCCGGATGACGGTGACCGCCGTCCCCACGGTGCGCGGCGCGCAGGTGCTC
TGCCATGTCACACCCCCGCGGCCGGTCACCCGCCGCGAGGTGCTGCACGTGCTGCAGCGC
GCCTACCGAGACCACCCGTTCGTCCGGATCGTGTCCCGCGGGCGCGGGGTGCACCGGATG
CCCGATCCGCAGTTCCTCGGCGGCACCAATTTCGTCGACATCGGTTGCGCCGTGGACGAG
GACGGCGGCCGCATCGTCCTGGTCGCCGCGCTGGACAACCTCGTGAAGGGGGCCGCGGGG
GGCGGGGTGCAGAGCCTGAACGTGGCGGCCGGCATGCCACAGGACGCCGGACTGGAATTC
ACCGGACTGCACCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000534 Semialdehyde dehydrogenase, NAD-binding (Domain)
 [2-124]  1.7e-25 SM00859
SM00859   Semialdehyde dehydrogenase, NAD bindin
 [2-108]  2.4e-23 PF01118
PF01118   Semialdhyde_dh
IPR000706 N-acetyl-gamma-glutamyl-phosphate reductase, type 1 (Family)
 [1-325]  7.2e-86 TIGR01850
TIGR01850   argC: N-acetyl-gamma-glutamyl-phosphate reductase
 [1-319]  31.732 MF_00150
MF_00150   ArgC_type1
IPR016040 NAD(P)-binding domain (Domain)
 [1-148]  4.5e-17 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit