close all open/close all

CDS information : Azino_00220


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction30,737 / 31,615 / + [in whole cluster]
30,737 / 31,615 / + [in contig]
Location30737..31615 [in whole cluster]
30737..31615 [in contig]
TypeCDS
Length879 bp (292 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative LysW-glutamate/LysW-aminoadipate kinase
Product (GenBank)Azi22
GeneaziC3
Gene (GenBank)azi22
EC number2.7.2.-
Keyword
  • aziridino[1,2a]pyrrolidinyl amino acid
Note
Note (GenBank)
  • acetylglutamate kinase
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q4JAQ2
PmId
[23434852] Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus. (Nat Chem Biol. , 2013)
ACC
O50147
PmId
[19620981] Discovery of proteinaceous N-modification in lysine biosynthesis of Thermus thermophilus. (Nat Chem Biol. , 2009)

close this sectionSequence

selected fasta
>putative LysW-glutamate/LysW-aminoadipate kinase [Azi22]
MAQDPRGHEPNPLIGGFAHDGPIVVKIGGGSDPEPVLDEVAELALAGRPTVLVHGGGAVA
DLLSEQLGVERRVIRSPDGTHSRRTDAAMLDVITLALLGRVKPRLISGLRARGARSVGLS
GADGALLTATRKPALRSVQDGRTVLIRDDRSGRIERVDPAPVRAVLDRGHVPVVSPPASD
AAGNLLNVDADEAAARLATALDASALVLLTDVGGVLADLGDPATRIARVGPHHLEGDVVR
GRMRHKVRAGLRASRTVRQVAIGAAHLHRPIHQALSGAGSRLCDEGERPEDG
selected fasta
>putative LysW-glutamate/LysW-aminoadipate kinase [Azi22]
ATGGCGCAGGATCCGAGGGGGCACGAGCCGAACCCGCTGATCGGCGGGTTCGCGCACGAC
GGGCCGATCGTGGTCAAGATCGGCGGCGGGAGCGACCCGGAGCCCGTACTGGACGAGGTG
GCCGAACTGGCGCTCGCCGGCCGGCCGACGGTACTCGTCCACGGCGGCGGAGCAGTCGCC
GACCTGCTGTCGGAACAACTCGGCGTGGAGCGGCGGGTGATCAGGTCCCCGGACGGCACG
CACAGCCGTCGCACGGACGCGGCCATGCTCGATGTCATCACCCTCGCCCTGCTCGGGCGG
GTGAAACCACGTCTGATCAGCGGATTACGGGCACGCGGCGCACGGTCGGTGGGCCTGAGC
GGCGCGGACGGCGCCCTGCTGACCGCCACCCGCAAACCGGCCCTGCGCTCCGTGCAGGAC
GGCCGGACCGTACTGATCCGGGACGACCGGTCCGGCCGCATCGAGCGCGTCGACCCCGCG
CCGGTCCGCGCGGTGCTGGACCGGGGGCACGTCCCCGTGGTCTCCCCGCCGGCCAGCGAC
GCCGCGGGCAACCTGCTCAACGTGGACGCCGACGAGGCGGCGGCCCGGCTGGCGACCGCC
CTGGACGCGTCGGCCCTGGTCCTGCTCACCGATGTGGGTGGCGTCCTGGCCGACCTCGGC
GACCCCGCCACCCGGATCGCGCGGGTGGGCCCGCACCACCTGGAAGGCGACGTCGTCCGA
GGACGGATGCGGCACAAGGTACGCGCCGGGCTGCGGGCCAGCAGGACCGTGCGGCAGGTG
GCCATCGGCGCCGCGCATCTGCACCGGCCGATCCACCAGGCCCTCTCCGGTGCCGGCAGC
CGGCTGTGCGACGAAGGGGAGAGGCCCGAAGATGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001048 Aspartate/glutamate/uridylate kinase (Domain)
 [22-274]  1.80000000000002e-47 G3DSA:3.40.1160.10
G3DSA:3.40.1160.10   Aa_kinase
 [23-260]  4.9e-26 PF00696
PF00696   AA_kinase
 [19-288]  4.50001022902825e-41 SSF53633
SSF53633   Aa_kinase
IPR001057 Glutamate/acetylglutamate kinase (Family)
 [47-61]  3.0999994589937e-05 PR00474 [189-216]  3.0999994589937e-05 PR00474
PR00474   GLU5KINASE
IPR004662 Acetylglutamate kinase (Family)
 [3-285]  4.39999001237694e-46 PIRSF000728
PIRSF000728   NAGK
 [23-260]  2.1e-49 TIGR00761
TIGR00761   ArgB
SignalP No significant hit
TMHMM No significant hit