close all open/close all

CDS information : Azino_00230


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction31,608 / 32,738 / + [in whole cluster]
31,608 / 32,738 / + [in contig]
Location31608..32738 [in whole cluster]
31608..32738 [in contig]
TypeCDS
Length1,131 bp (376 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative LysW-ornithine/LysW-gamma-lysine hydrolase
Product (GenBank)Azi23
GeneaziC10
Gene (GenBank)azi23
EC number
Keyword
  • aziridino[1,2a]pyrrolidinyl amino acid
Note
Note (GenBank)
  • N-acetyl-ornithine/N-acetyl-lysine deacetylase
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q8VUS5
PmId
[11852094] Characterization of a lysK gene as an argE homolog in Thermus thermophilus HB27. (FEBS Lett. , 2002)
[19620981] Discovery of proteinaceous N-modification in lysine biosynthesis of Thermus thermophilus. (Nat Chem Biol. , 2009)

close this sectionSequence

selected fasta
>putative LysW-ornithine/LysW-gamma-lysine hydrolase [Azi23]
MADHQRTADRTRPAAGDGDYPAWLLRAALGIPSVSGRELPVARFLADRMAELGLDSYVDE
VGNVHGLIGPRTGPTVMLLGHIDTVPGQVPVVQVGDLLYGRGAVDAKGSIVTMICAAART
EGVRVHVIGAVGEEVAGSRGAHHVLATVPPPAALVIGEPSGWDGVCLGYKGRIGIGYEIS
RPPLHTSSPEPTAVECAARFAHDIQEYLRGLSPEQDDPVAFGVAAATLVRLHGDLAEAEA
FLSCRVPPGFDFAALERFARSRPHSRIRVDERVPGVTRPRTDPVVSQLRAAIAAQGVRPT
LKRKAGTSDMNTLAPWGIPMAAYGPGDAHLDHTTDEHIPLGDLYRAIDVLALALPRLASR
LAAPPRTTGAPELLEA
selected fasta
>putative LysW-ornithine/LysW-gamma-lysine hydrolase [Azi23]
ATGGCTGACCACCAGCGCACCGCCGACCGTACCCGCCCCGCGGCGGGCGACGGGGACTAC
CCGGCCTGGCTCCTGCGGGCCGCGCTCGGCATCCCCTCGGTCTCCGGCCGGGAACTGCCC
GTCGCCCGCTTCCTCGCCGACCGGATGGCCGAGCTGGGCCTCGACTCGTACGTCGACGAG
GTCGGCAACGTGCACGGCCTGATCGGCCCGCGCACGGGCCCCACCGTCATGCTGCTCGGA
CACATCGACACCGTCCCCGGACAGGTACCGGTGGTCCAGGTCGGCGATCTGCTCTACGGC
CGCGGCGCGGTGGACGCGAAGGGCTCCATCGTCACCATGATCTGTGCCGCGGCCCGCACC
GAGGGAGTACGCGTGCACGTGATCGGCGCGGTCGGCGAGGAGGTCGCCGGCTCCCGCGGC
GCCCACCACGTGCTGGCCACGGTGCCGCCCCCGGCGGCGCTCGTGATCGGCGAACCGAGC
GGCTGGGACGGCGTCTGCCTGGGCTACAAGGGACGTATCGGCATCGGCTACGAGATCAGC
CGGCCACCCCTGCACACCAGCAGCCCGGAGCCGACCGCCGTGGAGTGCGCCGCCCGCTTC
GCCCACGACATACAGGAGTATCTGCGGGGACTCTCGCCCGAACAGGACGACCCGGTCGCC
TTCGGGGTCGCCGCCGCGACGCTCGTCCGGCTGCACGGCGATCTGGCCGAGGCCGAGGCC
TTCCTGAGCTGCCGGGTGCCGCCGGGGTTCGACTTCGCCGCGCTGGAACGCTTCGCCCGC
AGCAGACCGCACAGCCGCATCCGGGTGGACGAACGGGTCCCCGGAGTGACCCGGCCGCGC
ACCGACCCCGTGGTGAGCCAGCTCCGCGCCGCGATAGCCGCCCAGGGAGTCCGCCCGACG
CTCAAACGCAAGGCCGGCACCTCGGACATGAACACCCTCGCCCCCTGGGGCATCCCCATG
GCCGCCTACGGGCCGGGCGACGCCCACCTGGACCACACCACCGACGAACACATCCCGCTC
GGCGACCTGTACCGCGCGATCGACGTCCTGGCCCTCGCGCTGCCCCGGCTGGCGAGCCGC
CTCGCGGCGCCGCCGCGGACCACCGGCGCGCCCGAGCTGCTGGAGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001261 ArgE/DapE/ACY1/CPG2/YscS, conserved site (Conserved_site)
 [76-85]  PS00758
PS00758   ARGE_DAPE_CPG2_1
IPR002933 Peptidase M20 (Family)
 [77-353]  4.40000000000001e-23 PF01546
PF01546   Peptidase_M20
IPR010175 Acetyl-ornithine/Acetyl-lysine deacetylase (Family)
 [24-358]  1.10000000000001e-80 TIGR01902
TIGR01902   DapE-lys-deAc
SignalP
 [1-36]  0.207 Signal
Eukaryota   
TMHMM No significant hit