close all open/close all

CDS information : Azino_00240


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction32,741 / 33,559 / + [in whole cluster]
32,741 / 33,559 / + [in contig]
Location32741..33559 [in whole cluster]
32741..33559 [in contig]
TypeCDS
Length819 bp (272 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative oxidoreductase
Product (GenBank)Azi24
GeneaziC8
Gene (GenBank)azi24
EC number
Keyword
  • aziridino[1,2a]pyrrolidinyl amino acid
Note
Note (GenBank)
  • acyl-CoA dehydrogenase/reductase 33636
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q9RA05
PmId
[10473585] Stereoselective carveol dehydrogenase from Rhodococcus erythropolis DCL14. A novel nicotinoprotein belonging to the short chain dehydrogenase/reductase superfamily. (J Biol Chem. , 1999)
ACC
Q27YP6
PmId
[19770276] The final step of hygromycin A biosynthesis, oxidation of C-5''-dihydrohygromycin A, is linked to a putative proton gradient-dependent efflux. (Antimicrob Agents Chemother. , 2009)

close this sectionSequence

selected fasta
>putative oxidoreductase [Azi24]
MLDGDVALITGAARALGRSHALAFAREGADLILLDRCAPDDGPYPMAGRRDLEETAEACR
RLGSRVLTGVADVRHQADVDKVVDAGLDAFGRIDVLLNNAGVLGPGGVRVHELSEEQWQL
ALDVNLSGTWRTCRAVLPHMVERGGGRIVNTASTGGRVAFERYANYVASKHGVIGLTKSI
ALEYGRHGIRANAVCPTTVADDAALGTRSTRAVAASMGAELPDYERTSAALHPIGRLVTA
AEVSAACLWLAGDRSGGVTGTELLVDGGFTAH
selected fasta
>putative oxidoreductase [Azi24]
ATGCTCGACGGCGACGTCGCCCTGATCACCGGTGCTGCTCGCGCGCTGGGCCGGTCGCAC
GCGCTGGCCTTCGCCCGCGAGGGCGCGGACCTGATCCTCCTCGACCGCTGCGCCCCCGAC
GACGGCCCCTACCCGATGGCCGGCCGGCGTGACCTGGAGGAGACCGCGGAAGCCTGCCGA
AGGCTCGGCAGCCGCGTCCTGACCGGAGTCGCCGACGTACGCCACCAGGCGGACGTGGAC
AAGGTGGTGGACGCCGGGCTCGACGCGTTCGGCCGGATCGACGTCCTGCTCAACAACGCG
GGCGTCCTCGGTCCCGGCGGCGTCCGCGTACACGAACTCAGCGAGGAACAGTGGCAGTTG
GCGCTGGACGTCAACCTGAGCGGCACTTGGCGCACCTGCCGCGCAGTGCTGCCGCACATG
GTCGAGCGGGGCGGCGGACGGATCGTCAACACCGCCTCCACCGGCGGACGCGTCGCCTTC
GAGCGGTACGCCAACTACGTCGCCTCCAAGCACGGCGTGATCGGACTGACCAAGTCCATC
GCGCTGGAGTACGGACGCCACGGCATACGTGCCAACGCGGTCTGTCCCACCACCGTGGCC
GACGACGCCGCACTGGGCACCCGCAGCACCCGCGCCGTGGCCGCGTCGATGGGCGCCGAA
CTGCCCGACTACGAGCGCACGTCGGCGGCGCTGCATCCGATCGGCCGACTGGTCACCGCC
GCGGAGGTGTCGGCCGCCTGCCTCTGGCTGGCCGGTGACCGGTCCGGCGGTGTCACCGGC
ACCGAACTCCTGGTGGACGGCGGCTTCACCGCCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [91-102]  4.89999951782359e-13 PR00080 [146-154]  4.89999951782359e-13 PR00080 [166-185]  4.89999951782359e-13 PR00080
PR00080   SDRFAMILY
 [6-184]  1.3e-30 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [6-23]  8.20001307135067e-38 PR00081 [91-102]  8.20001307135067e-38 PR00081 [140-156]  8.20001307135067e-38 PR00081 [166-185]  8.20001307135067e-38 PR00081 [187-204]  8.20001307135067e-38 PR00081 [233-253]  8.20001307135067e-38 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-271]  5.00000000000001e-76 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [153-181]  PS00061
PS00061   ADH_SHORT
IPR023985 Carveol dehydrogenase (Family)
 [2-269]  6.60000000000002e-84 TIGR03971
TIGR03971   SDR_subfam_1
SignalP
 [1-25]  0.218 Signal
Bacteria, Gram-negative   
 [1-25]  0.215 Signal
Bacteria, Gram-positive   
TMHMM No significant hit