close all open/close all

CDS information : Azino_00250


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction33,636 / 38,261 / + [in whole cluster]
33,636 / 38,261 / + [in contig]
Location33636..38261 [in whole cluster]
33636..38261 [in contig]
TypeCDS
Length4,626 bp (1,541 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)Azi25
GeneaziA5
Gene (GenBank)azi25
EC number
Keyword
Note
Note (GenBank)
  • NRPS(C-A-PCP-RE)
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

B5 threonine
C64..360
A549..960
PCP1047..1114
R1166..1404

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [Azi25]
MDLPTEQPRSLPDTPVAAAVPPDLAALRSRLAELSPEKRRLVERLLARQGAGLGITRRAG
GAPEAPCSFEQERLWFMYELLTRREIFHVPVALRLEGELDPDALERALRQLGRRHEALRT
VFRQRDGRPYQVVREQLDLPLERVDCRTAADPALAARQQASALVTEDFDLEEGPLVRCTL
YRTGEHEHLLAVVQHHIVSDNWSLGILLDDLGKLYARELGAPGELPPLDLHYPDFAAWQR
ATVDSTTMRRTLDHWRDRLDGAPDSLDLPTDRPRPAVRGSQGKFHHVRFDADLVAGLREA
ARQHDTTLLGAFLAGYIALLSRLVRSDSLVVGVPVAGRPRAEMQQMIGYFLNWLPIHVQV
GDRPDLHTLIRRTGTALSEAMTHQDVPFDMLVRELRPSRRPGETPIFQTSFSLRDGAPTP
PAMPGIDVTFAELDGGATHYDLMAELWCEGDEVVGYVPYDDELLDAQTVARWAGWLKTLL
RAGLAAPDTPVADLEMLAPGESVVIPARAPVTAEGGVARPARTLHGVFAAQAARRPDAPA
VSDERDRLTYAELSARADRIAAALQERGEGPGSIVGLVLDRTVDLPAAVLGVLRAGAAYL
PVDPENPAGRTADQFTECRVRTVLTTPATASAPALEELDDGPRILVVDWQDPGWREQTPG
PAAVDVPADAPAYVIYTSGSTGRPKGVLVTHRNVLRLFTACDEHLRVGPDDVWTLFHSYA
FDFSVWEIWGALLHGGRLVVVPQWATRAPDVFAELVRDERVTVLSQTPSAFGQVSETLLK
HPDPAALRYVVFGGEALDPTALRPWTRVYGDRRPELINMYGITETTVHVTARPLREKDLA
GTASPIGPPLADLSLYLLDDSLRPVGTGVPGEIFVGGDGVSLGYVANPGLTAERMLPDPF
AGRPGARMYRSGDLAVRRGDGELVCLGRADDQVKIRGHRIEPGEVRAALDALAVVARAAV
VVERDRVGAAVLAAYVVPAEGNAGVSGTGIRRTLLRSLPEWMVPASVTVLDELPLTRNGK
LDRRALTDRKEHAAPAGPRGEAPRSDTARQLAEIWQELLGVPAVGGEDSFFELGGHSLMV
MHLVARIRTAFGVEMPVETLFRRPQLQPLADEVDAARTAAQRAAAPEPGQDAAAELADVR
ADLAARAAGIPRPGARADADRDTVLLTGATGFVGRFVLAELLAAGARVICLLRGGTARRE
ELVAGMADLGLWHEEHAARLELVDGDIAEPGLGLAGPDRDRLADRAGRIIHAAAWVNHVY
PYERLAAANTHCMAGLLELAARGRRSALTVVSTSSVADSAAYPPGSTVPPGPLKALPSAA
NGYVRSKAVAEQYLHLAAELDVPAAVIRIPSVFGDQRRYQINPADAVWSWCRAMIETSGF
PESFAQPGNELFQALPADAVARAVLLADRDHTEPGTRYLDAVPAAVGTTEDLLAALRAAG
HALSPCPDHAWYTAVGELDPGRVWVAGIAGQAAARLAADPSATAPRTLRRFTAPVEPGEL
DELLRTRALYSSAQLAGYIRTLDASFPPAGNDREKARPARG
selected fasta
>non-ribosomal peptide synthetase [Azi25]
ATGGATCTGCCCACCGAGCAGCCACGGTCCCTGCCGGACACGCCGGTGGCCGCCGCGGTG
CCGCCCGATCTCGCCGCCCTGCGCTCGCGGCTGGCCGAACTGAGCCCGGAAAAACGCCGG
TTGGTGGAGCGACTGCTGGCCCGTCAGGGCGCCGGCCTCGGCATCACCCGTCGCGCCGGC
GGTGCGCCCGAGGCCCCCTGCTCCTTCGAGCAAGAGCGGCTGTGGTTCATGTACGAGCTG
CTGACCCGGCGCGAGATCTTTCACGTCCCGGTCGCCCTGCGCCTCGAAGGCGAACTGGAC
CCCGACGCGCTGGAGCGGGCACTGCGGCAGCTCGGCCGACGGCACGAGGCACTGCGCACC
GTGTTCCGGCAGCGCGACGGCCGCCCCTACCAGGTGGTACGGGAACAGCTCGATCTCCCG
CTGGAGCGGGTCGACTGCCGCACCGCCGCCGATCCCGCCCTCGCCGCCCGGCAGCAGGCC
TCCGCACTGGTCACCGAGGACTTCGACCTCGAAGAAGGACCCCTGGTGCGCTGCACGCTG
TACCGGACGGGGGAACACGAACACCTGCTGGCCGTGGTGCAGCACCACATCGTCTCCGAC
AACTGGTCGCTGGGCATCCTGCTCGACGACCTCGGCAAGCTGTACGCCCGCGAGCTGGGG
GCACCGGGGGAGCTGCCCCCGCTCGACCTGCACTACCCCGACTTCGCCGCATGGCAGCGG
GCCACGGTCGACAGCACGACGATGCGGCGCACCCTCGATCACTGGCGCGACCGCCTGGAC
GGCGCCCCGGACAGTCTCGACCTGCCCACCGACCGTCCCCGGCCCGCGGTCCGCGGCAGC
CAGGGGAAGTTCCACCACGTACGGTTCGACGCCGACCTGGTCGCCGGGCTGCGCGAAGCG
GCCCGGCAGCACGACACCACCCTCCTGGGCGCGTTCCTCGCAGGGTACATAGCCCTGCTC
TCCCGCCTCGTGCGGTCGGACTCGCTGGTGGTCGGTGTACCGGTGGCCGGGCGGCCGCGC
GCGGAGATGCAGCAGATGATCGGGTACTTCCTGAACTGGCTGCCGATCCACGTCCAGGTC
GGTGACCGGCCGGACCTGCACACCCTGATACGCCGCACCGGAACCGCCCTGAGCGAGGCG
ATGACCCATCAGGACGTGCCGTTCGACATGCTGGTGCGCGAGCTGCGGCCCTCGCGGCGC
CCCGGGGAGACACCGATCTTCCAGACCTCCTTCTCGCTGCGTGACGGCGCCCCCACCCCG
CCGGCCATGCCGGGCATCGACGTCACCTTCGCCGAACTCGACGGCGGAGCCACCCATTAC
GACCTGATGGCCGAACTGTGGTGCGAGGGCGACGAGGTCGTGGGCTACGTGCCCTACGAC
GACGAACTGCTGGACGCGCAGACGGTGGCCCGCTGGGCCGGCTGGCTCAAGACGCTGCTG
CGCGCCGGGCTGGCCGCACCGGACACCCCGGTGGCGGACCTGGAGATGCTCGCTCCCGGC
GAGTCCGTGGTGATCCCGGCCCGCGCGCCGGTGACGGCCGAGGGGGGCGTCGCCCGGCCG
GCCCGGACCCTGCACGGGGTGTTCGCCGCGCAGGCGGCTCGGCGGCCCGACGCCCCCGCC
GTCTCCGACGAGCGGGACCGGCTCACCTACGCGGAACTGTCCGCACGAGCCGACCGGATC
GCCGCCGCCCTGCAAGAGCGGGGTGAGGGACCCGGCAGCATCGTCGGCCTCGTCCTCGAC
CGCACCGTGGACCTGCCCGCCGCCGTTCTCGGCGTGCTTCGCGCGGGTGCCGCCTACCTG
CCCGTCGACCCGGAGAATCCCGCCGGACGCACCGCTGACCAGTTCACCGAGTGCCGGGTC
CGGACCGTGCTGACCACCCCGGCCACCGCGTCGGCACCCGCGTTGGAGGAACTGGACGAC
GGACCGCGCATCCTCGTGGTGGACTGGCAGGACCCCGGATGGCGGGAGCAGACCCCCGGC
CCGGCTGCCGTGGACGTACCCGCGGACGCGCCCGCCTACGTCATCTACACCTCGGGATCC
ACCGGCCGCCCCAAGGGCGTGCTCGTCACGCACCGCAACGTGCTCCGGCTGTTCACCGCC
TGCGACGAGCATCTGAGGGTGGGGCCGGACGACGTATGGACCCTGTTCCACTCCTACGCC
TTCGACTTCTCCGTCTGGGAGATCTGGGGTGCGCTGCTGCACGGCGGCAGGCTGGTGGTC
GTCCCGCAGTGGGCGACCCGCGCCCCCGACGTCTTCGCCGAACTCGTACGGGACGAGCGG
GTCACCGTGCTGAGCCAGACCCCGTCCGCGTTCGGCCAGGTGAGCGAGACCCTGCTGAAG
CACCCCGACCCGGCGGCGCTGCGGTACGTGGTGTTCGGCGGCGAGGCACTCGATCCCACC
GCGCTGCGTCCCTGGACGCGTGTGTACGGCGACCGGCGGCCGGAACTGATCAACATGTAC
GGGATCACCGAGACCACCGTGCACGTCACCGCGCGGCCGCTGCGCGAGAAGGACCTCGCC
GGGACGGCGTCCCCGATCGGACCTCCGCTCGCCGACCTGTCCCTGTACCTGCTGGACGAT
TCCCTGCGTCCGGTCGGCACCGGTGTACCCGGGGAGATCTTCGTCGGAGGGGACGGGGTG
AGCCTGGGCTACGTCGCCAACCCGGGGCTGACCGCGGAGCGCATGCTCCCCGACCCGTTC
GCCGGACGTCCCGGCGCCCGTATGTACCGCAGCGGCGACCTGGCGGTCCGCCGCGGCGAC
GGAGAGCTGGTCTGTCTGGGCCGCGCCGACGACCAGGTGAAGATCCGCGGGCACCGGATC
GAGCCGGGTGAGGTCCGGGCGGCGCTGGACGCCCTGGCCGTCGTCGCCCGTGCCGCCGTG
GTGGTGGAACGCGACCGGGTGGGCGCCGCCGTCCTGGCGGCCTACGTCGTACCGGCCGAG
GGGAACGCCGGCGTCAGCGGCACCGGGATTCGCCGGACCCTGCTGCGCTCCCTGCCGGAA
TGGATGGTGCCCGCCTCGGTCACCGTCCTCGACGAGCTGCCCCTGACCCGGAACGGCAAG
CTGGACCGCCGGGCCCTGACCGACCGCAAGGAGCACGCGGCGCCGGCCGGACCGCGCGGC
GAGGCGCCCCGCAGCGACACCGCGCGGCAACTTGCCGAGATCTGGCAGGAGCTGCTCGGC
GTCCCCGCGGTGGGCGGCGAGGACAGCTTCTTCGAACTCGGCGGCCACTCCCTGATGGTG
ATGCACCTCGTCGCCCGGATACGCACGGCCTTCGGCGTCGAGATGCCGGTGGAGACCCTC
TTCCGCCGCCCTCAACTGCAGCCGCTGGCCGACGAGGTGGACGCGGCACGTACCGCGGCG
CAGAGGGCCGCGGCGCCGGAGCCGGGACAGGACGCGGCGGCCGAACTCGCCGACGTGCGC
GCCGACCTGGCCGCCCGGGCCGCCGGGATCCCCCGCCCGGGGGCCCGGGCGGACGCGGAC
CGCGACACAGTCCTGCTCACCGGGGCCACGGGCTTCGTCGGCCGGTTCGTGCTCGCCGAA
CTCCTTGCCGCGGGGGCCCGGGTGATCTGCCTGCTCCGCGGCGGGACCGCCCGCCGGGAG
GAGCTGGTGGCGGGGATGGCGGACCTCGGGCTGTGGCACGAGGAGCACGCCGCACGGCTG
GAACTGGTCGACGGCGACATCGCCGAACCCGGGCTCGGCCTCGCCGGACCGGACCGCGAC
CGCCTGGCCGACCGGGCGGGCCGCATCATCCACGCCGCGGCCTGGGTGAACCACGTCTAC
CCGTACGAGCGGCTGGCCGCGGCGAACACGCACTGCATGGCAGGTCTGCTGGAACTCGCG
GCCCGCGGCCGCCGCTCGGCTCTCACTGTGGTGTCCACCAGCTCGGTGGCCGACTCCGCC
GCGTACCCGCCCGGCTCGACCGTGCCGCCGGGCCCGCTGAAGGCACTGCCGTCCGCCGCG
AACGGATACGTGCGTTCCAAGGCGGTGGCCGAGCAGTACCTCCACCTGGCAGCCGAACTG
GACGTACCCGCCGCGGTGATCAGGATTCCCAGCGTCTTCGGCGATCAGCGGCGGTACCAG
ATCAACCCCGCAGACGCCGTGTGGAGTTGGTGCCGGGCGATGATCGAGACCAGCGGCTTC
CCCGAGAGCTTCGCGCAGCCGGGCAACGAACTGTTCCAGGCGCTGCCCGCCGACGCCGTG
GCCCGGGCGGTGCTGCTGGCCGACCGCGATCACACCGAACCGGGCACCCGCTACCTGGAC
GCCGTCCCGGCCGCCGTCGGCACGACAGAGGACCTGCTGGCCGCTCTGCGCGCCGCCGGT
CATGCACTGAGCCCCTGCCCGGACCACGCGTGGTACACCGCCGTGGGCGAGCTGGACCCC
GGCCGGGTCTGGGTGGCGGGCATCGCAGGGCAGGCCGCCGCCCGGCTGGCCGCGGATCCG
TCCGCCACGGCCCCCCGCACCCTGCGCCGCTTCACCGCCCCCGTGGAGCCCGGTGAGCTG
GACGAGCTGTTGCGCACCCGGGCCCTGTACTCCTCGGCCCAGCTGGCCGGGTACATCCGG
ACGCTCGACGCGTCCTTCCCGCCCGCCGGCAACGACCGGGAGAAAGCCCGGCCCGCGCGC
GGCTGA
[5] C64..360
[5] A549..960
[5] threonine722..828
[5] PCP1047..1114
[5] R1166..1404
[5] C190..1080
[5] A1645..2880
[5] threonine2164..2484
[5] PCP3139..3342
[5] R3496..4212

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [549-960]  3.10000000000005e-112 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [64-360]  1.5e-69 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1072-1087]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1040-1115]  9.30000048475975e-20 SSF47336
SSF47336   ACP_like
 [1049-1112]  1.8e-14 PF00550
PF00550   PP-binding
 [1039-1117]  3.09999999999998e-26 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1047-1114]  PS50075
PS50075   ACP_DOMAIN
IPR010071 Amino acid adenylation domain (Domain)
 [549-960]  1.60000000000002e-127 TIGR01733
TIGR01733   AA-adenyl-dom
IPR013120 Male sterility, NAD-binding (Domain)
 [1166-1404]  3.09999999999998e-43 PF07993
PF07993   NAD_binding_4
IPR016040 NAD(P)-binding domain (Domain)
 [1163-1367]  2.4e-23 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020845 AMP-binding, conserved site (Conserved_site)
 [674-685]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [1002-1028]  2.5e-05 PF13193
PF13193   DUF4009
SignalP
 [1-26]  0.043 Signal
Eukaryota   
 [1-34]  0.044 Signal
Bacteria, Gram-negative   
TMHMM No significant hit