close all open/close all

CDS information : Azino_00290


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction45,500 / 46,513 / + [in whole cluster]
45,500 / 46,513 / + [in contig]
Location45500..46513 [in whole cluster]
45500..46513 [in contig]
TypeCDS
Length1,014 bp (337 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)Azi29
GeneaziU3
Gene (GenBank)azi29
EC number
Keyword
Note
Note (GenBank)
  • hypothetical protein
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
[23039858] Essential role of an unknown gene aziU3 in the production of antitumor antibiotic azinomycin B verified by utilizing optimized genetic manipulation systems for Streptomyces sahachiroi. (FEMS Microbiol Lett. , 2012)

close this sectionSequence

selected fasta
>hypothetical protein [Azi29]
MTTTAPPVELWTRDLGSCLHGTLATALIRDGHDPVTVLGAPWEFRRRPGAWSSEEYFFFA
EPDSLAGRLALYHPFESTWHRSDGDGVDDLREALAAGVLPIAAVDNFHLPFRPAFHDVHA
AHLLVVYRITETEVYVSDAQPPAFQGAIPLADFLASWGSLNPPDDADVFFSASPSGRRWL
RTRMTGPVPEPDRHWVGRVIRENVARYRQEPPADTQTGLPGLRRYLDELCALTPGTNAAS
EALSELYVISWNIQAQSGLHAEFLRAHSVKWRIPELAEAAAGVDAVAHGWTGVRMTGAHS
RVWQRHRPAELRGHATALVRRLEAALDLLELAADAVS
selected fasta
>hypothetical protein [Azi29]
ATGACCACCACCGCACCGCCCGTCGAACTCTGGACACGCGACCTGGGAAGCTGCCTGCAC
GGCACCCTGGCGACGGCGCTGATCCGCGACGGCCACGACCCGGTCACCGTCCTCGGCGCG
CCCTGGGAGTTCCGCCGCCGCCCCGGGGCCTGGAGCTCGGAGGAGTACTTCTTCTTCGCG
GAACCCGATTCGCTCGCCGGGCGGCTCGCCCTCTACCACCCCTTCGAGTCGACCTGGCAC
CGCAGTGACGGCGACGGCGTGGACGACCTGCGCGAGGCGCTCGCGGCAGGCGTGCTGCCC
ATCGCCGCCGTCGACAACTTCCATCTGCCCTTCCGGCCCGCCTTCCACGACGTACACGCC
GCGCACCTCCTCGTGGTCTACCGGATCACCGAGACCGAGGTGTACGTCTCCGACGCCCAG
CCCCCTGCCTTCCAGGGCGCGATCCCGCTCGCCGACTTCCTGGCGAGCTGGGGATCGCTC
AACCCGCCGGACGACGCGGACGTGTTCTTCAGCGCCAGCCCCAGTGGCCGCCGCTGGCTG
AGGACCCGTATGACGGGCCCCGTCCCGGAACCGGACCGGCACTGGGTCGGCCGTGTCATC
CGGGAGAACGTCGCCCGGTACCGGCAGGAGCCCCCTGCGGACACCCAGACGGGACTGCCC
GGCCTGCGCCGGTACCTCGACGAGCTGTGCGCGCTCACTCCCGGCACGAACGCGGCGTCC
GAGGCCCTGAGCGAGCTGTACGTCATCTCGTGGAACATCCAGGCCCAGAGCGGCTTGCAC
GCCGAGTTCCTGCGCGCCCACTCGGTGAAATGGCGGATCCCGGAACTGGCGGAAGCAGCG
GCCGGTGTCGACGCGGTGGCACACGGCTGGACCGGGGTACGCATGACCGGCGCCCACTCA
CGCGTCTGGCAGCGGCACCGGCCGGCGGAACTGCGCGGGCACGCCACCGCACTCGTCCGG
CGCCTCGAAGCCGCCCTCGACCTGCTCGAACTCGCCGCGGACGCGGTGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-24]  0.234 Signal
Eukaryota   
TMHMM No significant hit