close all open/close all

CDS information : Azino_00300


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction46,593 / 47,456 / + [in whole cluster]
46,593 / 47,456 / + [in contig]
Location46593..47456 [in whole cluster]
46593..47456 [in contig]
TypeCDS
Length864 bp (287 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative alpha-amino acid--LysW ligase
Product (GenBank)Azi30
GeneaziC2
Gene (GenBank)azi30
EC number
Keyword
  • aziridino[1,2a]pyrrolidinyl amino acid
Note
Note (GenBank)
  • ribosomal protein S6 modification protein
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q72HE6
PmId
[19620981] Discovery of proteinaceous N-modification in lysine biosynthesis of Thermus thermophilus. (Nat Chem Biol. , 2009)
ACC
Q4J8E7
PmId
[23434852] Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus. (Nat Chem Biol. , 2013)

close this sectionSequence

selected fasta
>putative alpha-amino acid--LysW ligase [Azi30]
MPIAVVASRIRREERLILEAFERLGLRCEHVDPRGLRLLLADGRPPYRAALMREVSHSRA
ASVATTLEALGVPTYNRPRVLDVCGDKLRTALAFHSAGLRMPQAAATWGTGAALEAMPKL
GYPVVVKPVTGSWGHLTTRVRDEEQGRAVLEHRAALPNPQQHVFFLQEHIDKPGRDIKAY
VAGDRVICAIYKNAVDDWRTNTAIGGAATPCPITPELTELAVAAAHAVGGGFLGVDLLID
QQERLYANEVNHTPEFHGAVDATGIDVAQGIVEWAVAEIEAQERAAA
selected fasta
>putative alpha-amino acid--LysW ligase [Azi30]
ATGCCCATAGCCGTGGTCGCCTCCCGGATACGCCGCGAGGAGCGGCTGATCCTCGAAGCG
TTCGAGCGGCTCGGGCTGCGCTGCGAGCACGTCGATCCGCGCGGGCTCAGGCTGCTGCTC
GCCGACGGCCGGCCGCCCTACCGGGCCGCGCTCATGCGCGAAGTGAGCCACAGCCGTGCC
GCCTCCGTAGCGACCACGCTGGAAGCGCTCGGGGTCCCCACCTACAACAGGCCCCGCGTA
CTGGACGTCTGCGGCGACAAACTGCGCACCGCCCTCGCCTTCCACAGCGCCGGGCTCCGG
ATGCCGCAGGCCGCGGCGACCTGGGGCACGGGGGCGGCCCTGGAAGCGATGCCCAAGCTC
GGGTACCCCGTCGTGGTCAAACCCGTCACCGGTTCGTGGGGACACCTGACCACGCGCGTC
CGCGACGAGGAGCAGGGCCGGGCCGTTCTCGAACACCGTGCCGCCCTGCCGAACCCGCAG
CAGCACGTCTTCTTCCTGCAGGAGCACATCGACAAACCCGGGCGCGACATCAAGGCCTAC
GTCGCGGGTGACCGGGTGATCTGCGCGATCTACAAGAACGCGGTCGACGACTGGCGGACC
AACACCGCCATCGGAGGCGCGGCGACCCCCTGTCCGATCACCCCCGAACTGACGGAGCTC
GCCGTCGCGGCGGCACACGCGGTAGGAGGCGGGTTCCTCGGCGTCGACCTGCTCATCGAC
CAGCAGGAGCGCCTCTACGCCAACGAGGTCAACCACACCCCCGAGTTCCACGGCGCCGTC
GACGCGACCGGGATCGACGTCGCGCAAGGCATCGTCGAGTGGGCCGTCGCGGAGATCGAG
GCACAGGAAAGGGCGGCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004666 Ribosomal S6 modification enzyme RimK/Lysine biosynthesis enzyme LysX (Family)
 [3-275]  1.99999999999999e-70 TIGR00768
TIGR00768   RimK_fam
IPR011761 ATP-grasp fold (Domain)
 [91-276]  PS50975
PS50975   ATP_GRASP
IPR013651 ATP-grasp fold, RimK-type (Domain)
 [85-274]  1.70000000000001e-38 PF08443
PF08443   RimK
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [78-152]  1.1e-12 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   ATP_grasp_subdomain_1
IPR013816 ATP-grasp fold, subdomain 2 (Domain)
 [174-270]  7.4e-11 G3DSA:3.30.470.20
G3DSA:3.30.470.20   ATP_grasp_subdomain_2
IPR016185 Pre-ATP-grasp fold (Domain)
 [2-86]  1.89999859865865e-17 SSF52440
SSF52440   PreATP-grasp-like
SignalP No significant hit
TMHMM No significant hit