close all open/close all

CDS information : Azino_00310


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction47,453 / 48,184 / + [in whole cluster]
47,453 / 48,184 / + [in contig]
Location47453..48184 [in whole cluster]
47453..48184 [in contig]
TypeCDS
Length732 bp (243 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)Azi31
GeneaziC1
Gene (GenBank)azi31
EC number
Keyword
Note
Note (GenBank)
  • conserved hypothetical protein
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [Azi31]
MSATAGPPSLLALWSAPRSRSTVFFRMMVERQDVLALHEPFCNIANDGSTVIDGRVVHST
DTLTDTLIGLAAQRTVFFKDTTDCFYDSVFARPDFLKSGHHAFLLRNPKEIIPSYAAIKP
DMACHEVGIAYLHRIHQAVLDAGGSAVILDSDDFVDHPEATVRQYCATVGLPFRADALQW
QPGQRPEWSQSARWHTDVSATSTIRRRERTYDRTTDNDPLLQRFYEHHIPFYEYLWERRL
RIS
selected fasta
>hypothetical protein [Azi31]
ATGAGCGCGACGGCCGGTCCCCCCTCGTTGCTCGCGCTGTGGAGCGCGCCCCGCTCCCGC
TCCACGGTGTTCTTCCGGATGATGGTGGAACGCCAGGACGTCCTGGCGCTGCACGAGCCG
TTCTGCAACATCGCCAACGACGGCAGCACCGTGATCGACGGCCGCGTGGTGCACAGCACG
GACACCCTGACGGACACGCTCATCGGACTCGCGGCACAGCGAACGGTGTTCTTCAAGGAC
ACCACCGACTGCTTCTACGACTCCGTGTTCGCACGTCCGGACTTCCTCAAGAGCGGGCAC
CACGCCTTCCTGCTGAGGAACCCGAAGGAGATCATCCCGTCGTACGCGGCCATCAAGCCG
GACATGGCCTGTCACGAAGTGGGCATCGCCTACCTCCACCGGATCCACCAGGCGGTACTC
GACGCCGGCGGCAGTGCGGTGATCCTGGACTCCGACGACTTCGTGGACCACCCGGAGGCG
ACCGTCCGGCAGTACTGCGCGACGGTGGGCCTGCCCTTCCGCGCCGACGCCCTCCAATGG
CAGCCGGGTCAGCGGCCGGAGTGGAGCCAGTCCGCGCGCTGGCACACGGATGTCAGCGCC
ACGTCGACGATACGGCGCCGCGAGCGGACCTACGACAGGACGACGGACAACGACCCGCTG
CTGCAACGCTTCTACGAACACCACATTCCCTTCTACGAGTACCTGTGGGAGCGGCGGCTC
CGGATCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-25]  0.506 Signal
Bacteria, Gram-positive   
 [1-21]  0.957 Signal
Eukaryota   
TMHMM No significant hit