close all open/close all

CDS information : Azino_00320


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction48,254 / 49,513 / + [in whole cluster]
48,254 / 49,513 / + [in contig]
Location48254..49513 [in whole cluster]
48254..49513 [in contig]
TypeCDS
Length1,260 bp (419 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative cytochrome P450
Product (GenBank)Azi32
GeneaziC9
Gene (GenBank)azi32
EC number
Keyword
  • aziridino[1,2a]pyrrolidinyl amino acid
Note
Note (GenBank)
  • cytochrome P450
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q9L9F9
PmId
[11325587] Coumarin formation in novobiocin biosynthesis: beta-hydroxylation of the aminoacyl enzyme tyrosyl-S-NovH by a cytochrome P450 NovI. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative cytochrome P450 [Azi32]
MIISKPPFCPVQFQDSDLLNSGFHAATDMHALWADLRENQPLYRADPGGGREPFWVVTRH
EDVSRVLRSHGEFSSRRGTILCVLDLNTADIASDNMMADTDPPRHREFREPLNKAFAPSV
VATQERLLRELSQDLIQSVLEAGVYDIAHKTMMFPMAVTGTLMGLPPESWERLAELVMMT
IAYDDPDYSAGSAQATVRQARHELFEYFQKEYAQRSRDDVDPDVIGAMVGMDLSEGPMTQ
EQVLLNAFVLLIGANVTTPHALCTLMSVMAEHPEQYRAVQENPELRASCLQELLRWSSPV
TALMRYAVKDVEMHGRTIRAGEPVTAWIGAANRDERVFPDPYTFDVARRPNKHLAFGLGP
HYCIGANLAKVGLDIFLDELLERVESIEIAGEVKHVASHFVPGYKSMPVRFTPREAHVR
selected fasta
>putative cytochrome P450 [Azi32]
ATGATTATTTCCAAGCCCCCGTTCTGCCCGGTGCAGTTCCAGGACTCCGACCTGCTCAAC
TCCGGATTCCACGCCGCCACGGACATGCACGCGCTCTGGGCCGACCTGCGTGAGAACCAG
CCGCTCTACCGGGCCGACCCCGGCGGTGGCCGGGAGCCGTTCTGGGTCGTGACCCGCCAC
GAGGACGTCAGCCGGGTGCTGCGCAGCCACGGGGAGTTCTCCTCCCGGCGGGGCACGATC
CTGTGCGTGCTCGACCTCAACACCGCGGACATCGCGTCCGACAACATGATGGCCGACACC
GATCCGCCCCGGCACCGGGAGTTCAGGGAGCCGCTCAACAAGGCGTTCGCCCCCTCCGTG
GTCGCCACTCAGGAGCGGCTGCTCAGAGAACTGTCGCAGGACCTGATCCAGTCGGTCCTG
GAAGCCGGCGTGTACGACATCGCCCACAAGACGATGATGTTCCCGATGGCCGTCACGGGC
ACGCTCATGGGCCTGCCCCCCGAGTCCTGGGAAAGGCTCGCGGAGCTGGTCATGATGACG
ATCGCCTACGACGACCCCGACTACTCCGCCGGCAGTGCGCAGGCCACCGTGCGCCAGGCC
CGGCACGAGCTGTTCGAGTACTTCCAGAAGGAGTACGCGCAGCGGAGCCGGGACGACGTC
GACCCCGACGTCATCGGCGCGATGGTCGGCATGGATCTCTCGGAAGGACCGATGACGCAG
GAGCAGGTCCTCCTCAACGCCTTCGTGCTGCTCATCGGCGCGAACGTCACCACGCCGCAC
GCCCTGTGCACCCTGATGTCCGTGATGGCCGAACACCCGGAGCAGTACCGGGCCGTACAG
GAGAACCCCGAGCTGCGGGCGTCCTGCCTCCAGGAGCTCCTGCGCTGGTCCTCCCCGGTC
ACCGCGCTGATGCGGTACGCCGTCAAGGACGTGGAGATGCACGGCCGAACCATCCGGGCG
GGCGAGCCGGTCACCGCGTGGATCGGCGCGGCCAACCGGGACGAGAGGGTCTTCCCCGAC
CCCTACACCTTCGATGTCGCACGACGGCCGAACAAGCACCTCGCCTTCGGCCTGGGACCG
CACTACTGCATCGGCGCCAACCTGGCCAAGGTCGGCCTCGACATCTTCCTCGACGAACTC
CTGGAGCGGGTGGAGAGCATCGAGATCGCCGGCGAGGTGAAGCACGTCGCCTCCCACTTC
GTGCCCGGCTACAAGAGCATGCCGGTGCGGTTCACTCCTCGTGAGGCACACGTACGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [2-419]  1e-87 SSF48264
SSF48264   Cytochrome_P450
 [25-415]  8.49999999999995e-96 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [194-383]  1.3e-24 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [100-111]  6.99997659850661e-34 PR00359 [162-177]  6.99997659850661e-34 PR00359 [207-229]  6.99997659850661e-34 PR00359 [288-299]  6.99997659850661e-34 PR00359 [305-332]  6.99997659850661e-34 PR00359 [333-348]  6.99997659850661e-34 PR00359 [354-363]  6.99997659850661e-34 PR00359 [363-374]  6.99997659850661e-34 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [356-365]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit