close all open/close all

CDS information : Azino_00340


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction50,308 / 51,456 / + [in whole cluster]
50,308 / 51,456 / + [in contig]
Location50308..51456 [in whole cluster]
50308..51456 [in contig]
TypeCDS
Length1,149 bp (382 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA dehydrogenase
Product (GenBank)Azi34
GeneaziD3
Gene (GenBank)azi34
EC number1.3.99.-
Keyword
Note
Note (GenBank)
  • putative acyl-CoA dehydrogenase
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Family/Domain
FD
IPR013786, IPR006091, IPR009075

close this sectionSequence

selected fasta
>putative acyl-CoA dehydrogenase [Azi34]
MPPQSVDFANEVEEILTAPETERLLRELATRQDGMDGDPRALYRHLGDAGILAPSWPVEY
GGRGADFTATVALLEKLVAHRIPQNLYCISVQNVGSLILAAGSEQQRRTLLPALASTELT
SCILFTEPGNGSDLAGITTTAVRDGTGWVLNGRKTYNLKSAYADIALIAVRTDPQSSQYE
GLTLFLVPLDAPGVVIRPIPSLADEQFHDIWFTDVRVDESALFGQVGEGWSLITQMFAAE
RTGLDYYARGRHWLDLVAQRVDRNGARQSDAVRTELARHEARITASKLLSCQVMQNLQDG
SPDIAESSFAKWHCSESAQRIAWWALDTLGQDLLEPGPDPGDRTLEAAFREAPGMTISGG
ASEVMLDILSSARVFTHAPRED
selected fasta
>putative acyl-CoA dehydrogenase [Azi34]
GTGCCACCTCAGAGCGTCGACTTCGCGAACGAGGTCGAGGAGATTCTGACGGCCCCGGAG
ACGGAACGGCTGCTGCGGGAGCTCGCCACCCGGCAGGACGGCATGGACGGCGACCCCCGT
GCCTTGTACCGGCATCTGGGCGACGCAGGGATCCTCGCTCCCTCCTGGCCGGTCGAATAC
GGCGGCAGGGGCGCCGACTTCACCGCGACCGTGGCGCTGCTGGAAAAGCTCGTCGCCCAC
CGGATACCGCAGAATCTGTACTGCATCTCGGTGCAGAACGTCGGCTCCCTGATCCTGGCC
GCGGGCTCGGAGCAGCAGCGCCGGACGCTGCTGCCCGCCCTGGCGAGCACCGAACTCACG
TCGTGCATCCTGTTCACCGAGCCCGGCAACGGATCCGACCTGGCAGGCATCACCACGACC
GCGGTGCGCGACGGCACCGGCTGGGTCCTCAACGGGCGCAAGACCTACAACCTCAAGAGC
GCCTACGCCGACATCGCGCTCATCGCGGTACGGACCGATCCGCAGAGCAGCCAGTACGAG
GGACTCACCCTCTTCCTCGTCCCGCTGGACGCACCCGGTGTCGTCATCCGCCCCATTCCC
AGCCTGGCCGACGAGCAGTTCCACGACATCTGGTTCACCGATGTGCGTGTCGACGAGTCA
GCGCTGTTCGGCCAGGTCGGCGAGGGCTGGTCGCTGATCACTCAGATGTTCGCCGCGGAG
CGCACGGGGCTGGACTACTACGCGCGGGGACGCCACTGGCTGGATCTCGTCGCGCAGCGT
GTCGACAGGAACGGTGCACGGCAGTCCGATGCCGTACGCACCGAACTGGCCCGTCACGAG
GCGCGGATCACCGCGAGCAAACTGCTGAGCTGCCAGGTCATGCAGAACCTTCAGGACGGC
AGTCCCGACATCGCCGAATCCTCCTTCGCGAAATGGCACTGCAGCGAATCGGCCCAGCGC
ATCGCCTGGTGGGCCCTGGACACCCTGGGCCAGGACCTGCTGGAACCCGGGCCCGACCCC
GGTGACCGCACTCTGGAGGCAGCCTTCCGGGAGGCACCGGGAATGACCATCTCCGGCGGG
GCCTCGGAGGTCATGCTGGACATTCTGAGCAGCGCCCGGGTATTCACCCACGCCCCGAGG
GAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [227-371]  8.00000000000001e-20 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [122-173]  4.80000000000001e-17 PF02770
PF02770   Acyl-CoA_dh_M
 [121-216]  1.6e-27 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [26-118]  1.2e-14 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [217-371]  1.9e-20 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [227-374]  1.80000149287196e-15 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [21-227]  2.1000026783403e-55 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [26-119]  4.10000000000001e-17 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit