close all open/close all

CDS information : Azino_00350


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction51,462 / 52,463 / + [in whole cluster]
51,462 / 52,463 / + [in contig]
Location51462..52463 [in whole cluster]
51462..52463 [in contig]
TypeCDS
Length1,002 bp (333 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)Azi35
GeneaziD2
Gene (GenBank)azi35
EC number
Keyword
Note
Note (GenBank)
  • putative acyl-CoA dehydrogenase family protein
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
Family/Domain
FD
IPR009075

close this sectionSequence

selected fasta
>putative oxidoreductase [Azi35]
MDLRPDPFQQRLRSAVDTVLTRTGDLPAQLADIGVPSLGAPERLGGFALGLSADIVVNER
LGHGLEPLDSYRATAFALDLLDCDGAPTELLAEILADLYKGTRHAVVVGARGGGAVQVRD
GGRLWGESESLPAGDIALCIVRTAGEDGAAWRLAIPEPGTCVTEPAEHLGIPASRLRFHG
APSQSLPVTTAHWQRALAAARIRQAALLLGIADWITDVARAHVNTRTQSGKPLVERQTVA
HRLAVLIGEGEGWKLLLNKAAWEFDRGGRPDAAAMLAVAGEHAQLASRIALQLHGVRGML
AHSTAASVYRMVAVESARLGTPAALWREAGSAA
selected fasta
>putative oxidoreductase [Azi35]
ATGGACCTGCGACCTGATCCGTTCCAGCAGCGTCTGCGCAGCGCCGTGGACACGGTCCTC
ACGCGCACCGGCGACCTCCCCGCTCAACTGGCGGACATCGGCGTGCCCTCCCTCGGCGCA
CCGGAGCGCCTCGGCGGCTTCGCGCTCGGACTCAGCGCCGACATCGTCGTGAACGAACGC
CTCGGACACGGACTCGAACCGCTCGACAGCTATCGGGCGACCGCGTTCGCGCTCGACCTG
CTCGACTGCGACGGCGCACCCACGGAACTGCTGGCCGAGATCCTCGCTGACCTGTACAAG
GGCACCCGGCACGCGGTGGTCGTGGGGGCGCGAGGCGGCGGCGCCGTACAAGTGCGGGAC
GGAGGCCGGCTGTGGGGCGAGTCGGAATCGCTGCCTGCGGGTGACATCGCGCTGTGCATC
GTGCGAACCGCCGGCGAGGACGGCGCCGCATGGCGTCTGGCGATTCCGGAACCCGGCACC
TGCGTCACGGAGCCGGCGGAGCATCTCGGCATACCCGCCTCGCGATTGAGATTCCACGGT
GCGCCGTCCCAGTCTCTGCCGGTGACCACCGCTCACTGGCAGCGGGCCCTGGCGGCGGCG
CGGATCCGGCAGGCGGCACTGCTGCTGGGCATCGCCGACTGGATCACCGATGTGGCCCGC
GCCCATGTCAACACCCGCACGCAGTCCGGCAAACCGCTCGTGGAGCGGCAGACGGTCGCC
CACCGGCTGGCCGTCCTGATCGGCGAGGGGGAGGGCTGGAAGCTCCTGCTGAACAAGGCG
GCCTGGGAGTTCGACCGCGGCGGGCGCCCCGACGCGGCGGCGATGCTGGCGGTCGCCGGC
GAACACGCGCAGCTCGCCAGCCGCATCGCCCTCCAACTGCACGGCGTACGGGGAATGCTC
GCGCACTCGACAGCGGCATCCGTGTACCGGATGGTGGCCGTGGAGTCGGCGCGGCTGGGC
ACCCCCGCCGCGCTGTGGCGGGAAGCCGGATCCGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [195-316]  4.2e-16 PF00441
PF00441   Acyl-CoA_dh_1
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [188-333]  4.99999811956429e-16 SSF47203
SSF47203   AcylCoADH_C_like
 [195-321]  1.5e-19 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
SignalP No significant hit
TMHMM No significant hit