close all open/close all

CDS information : Azino_00360


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction52,571 / 53,686 / + [in whole cluster]
52,571 / 53,686 / + [in contig]
Location52571..53686 [in whole cluster]
52571..53686 [in contig]
TypeCDS
Length1,116 bp (371 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
ProductAzinomycin B resistance protein
DNA glycosylase/DNA binding protein
Product (GenBank)Azi36
Geneorf1
Gene (GenBank)azi36
EC number
Keyword
Note
  • bifunctional protein
Note (GenBank)
  • hypothetical protein
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)
[26400161] Characterization of a novel DNA glycosylase from S. sahachiroi involved in the reduction and repair of azinomycin B induced DNA damage. (Nucleic Acids Res. , 2016)

close this sectionSequence

selected fasta
>Azinomycin B resistance protein [Azi36]
MKASWRQVFAWRMQRQFLEPRTQPSASDVVGRLCGVQAQVWSVAELNVALRQAAPDRESV
NREVADLSLMKTWAMRGTLHLLRPSEAGPYLSLMANTGSWLKPSWTRASGVTPRQVDELT
EEVAGILDGVVLTRDELVTRLVADKRFVSMEERLRSGWGSVLKPLAWRGVLCHGPNRGNK
ITFTLPASQFGADWGKMPEPDEAAPTVIKAYLGAYGPATIETFDRWLSLNSTSKPKLRKW
FGDMGDELTEVDVEGRKAFVLTEHAEELAATAPCTGIRLLGGFDQYLLGPGTKDEVVLAP
EHRSAVSRAAGWISPVVVKDGRVVGVWEIVDQELVVTPFPDTERLPVKAVEKEAAHVARA
SGVSRLPVRIV
selected fasta
>Azinomycin B resistance protein [Azi36]
GTGAAGGCCAGCTGGAGACAGGTATTTGCGTGGCGGATGCAGCGGCAGTTCCTGGAGCCG
CGTACCCAGCCGAGTGCGAGTGACGTCGTCGGCAGACTCTGTGGCGTGCAGGCACAGGTC
TGGAGTGTCGCCGAGCTGAACGTCGCACTTCGGCAGGCGGCACCCGACCGGGAAAGCGTC
AACCGGGAGGTCGCCGACCTCTCGTTGATGAAGACCTGGGCGATGCGCGGAACCCTGCAC
CTCCTGCGGCCGAGCGAGGCCGGGCCCTACCTGTCGCTCATGGCGAACACGGGAAGCTGG
CTCAAGCCGTCCTGGACCCGGGCCTCCGGCGTCACGCCCCGACAGGTCGACGAGCTGACC
GAAGAGGTGGCGGGAATCCTCGACGGAGTGGTGCTCACCCGGGATGAGCTCGTCACCCGG
CTCGTCGCCGACAAGCGGTTCGTGAGCATGGAGGAGCGACTGCGGTCGGGGTGGGGCTCC
GTGCTCAAACCGCTGGCCTGGCGAGGCGTCCTGTGCCACGGCCCGAACCGGGGCAACAAG
ATCACGTTCACGCTGCCGGCGAGCCAGTTCGGTGCGGACTGGGGCAAGATGCCCGAACCC
GACGAGGCGGCGCCCACGGTGATCAAGGCCTACCTGGGCGCGTACGGCCCTGCGACGATC
GAGACCTTCGACCGCTGGCTGTCGCTCAACAGCACGAGCAAGCCGAAGCTGCGCAAGTGG
TTCGGCGACATGGGCGACGAGCTCACCGAGGTCGACGTCGAGGGGCGCAAGGCCTTCGTC
CTGACGGAGCACGCGGAGGAACTCGCCGCCACCGCCCCGTGCACCGGCATCAGGCTGCTC
GGCGGCTTCGACCAGTACCTCCTCGGCCCCGGAACCAAGGACGAGGTCGTCCTCGCACCG
GAACACCGCTCCGCGGTGAGCCGCGCCGCCGGCTGGATCTCCCCCGTGGTCGTGAAGGAC
GGCAGAGTCGTCGGGGTGTGGGAGATCGTCGACCAGGAGCTGGTGGTGACCCCGTTCCCG
GACACCGAACGGCTCCCTGTGAAGGCGGTCGAGAAGGAGGCCGCGCACGTCGCCCGCGCC
AGCGGAGTGAGCCGGCTGCCGGTGCGCATCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009351 Protein of unknown function DUF1006 (Family)
 [11-359]  4.10000000000004e-52 PF06224
PF06224   DUF1006
SignalP No significant hit
TMHMM No significant hit