close all open/close all

CDS information : Azino_00370


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction54,252 / 53,725 / - [in whole cluster]
54,252 / 53,725 / - [in contig]
Locationcomplement(53725..54252) [in whole cluster]
complement(53725..54252) [in contig]
TypeCDS
Length528 bp (175 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)Azi37
Geneorf2
Gene (GenBank)azi37
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • hypothetical protein
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [Azi37]
MIWRTEVLDQLDLYWDHHLMPRLAGLTDDEYLWEPVADCWSVRVGEDGRASLDLRRPAPE
PPPVTTIAWRMCHVAFHVLGIRSSAHFGDGSLTLETASIPVTAADGLGALHEHYHAWRKG
VLSLDDAELARPIGDVEGPWGERPMATLLLHVNREVMHHGGEIALLRDLYRARFA
selected fasta
>hypothetical protein [Azi37]
ATGATCTGGCGAACCGAGGTCCTCGATCAGCTCGACCTGTACTGGGACCACCACTTGATG
CCCAGGCTGGCCGGTCTCACCGACGACGAGTATCTGTGGGAGCCGGTGGCGGACTGCTGG
TCGGTCCGCGTCGGCGAGGACGGAAGGGCCTCGCTCGACCTGCGACGCCCCGCCCCCGAG
CCGCCTCCCGTGACGACGATCGCCTGGCGCATGTGCCACGTCGCCTTTCACGTACTGGGC
ATCCGGTCCAGCGCTCACTTCGGCGACGGATCACTGACCTTGGAGACCGCGTCCATCCCC
GTCACGGCCGCGGACGGGCTCGGGGCGCTGCACGAGCACTACCACGCATGGCGCAAGGGG
GTGCTCTCCCTCGACGACGCGGAACTGGCGCGGCCCATAGGAGATGTCGAGGGGCCGTGG
GGAGAGCGGCCGATGGCGACCCTGCTCCTGCACGTCAATCGTGAAGTGATGCATCACGGA
GGGGAGATCGCCCTGCTCCGCGATCTCTACCGCGCCCGCTTCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR024775 DinB-like domain (Domain)
 [18-163]  5.8e-15 PF12867
PF12867   DinB_2
SignalP No significant hit
TMHMM No significant hit