close all open/close all

CDS information : Azino_00380


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction54,572 / 54,958 / + [in whole cluster]
54,572 / 54,958 / + [in contig]
Location54572..54958 [in whole cluster]
54572..54958 [in contig]
TypeCDS
Length387 bp (128 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)Azi38
Geneorf3
Gene (GenBank)azi38
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • hypothetical protein
Reference
ACC
PmId
[18635006] Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [Azi38]
MSDRVQVTVDAHDPRALSSFWSAALGYVHVGAEGERDTRAVLEDPEGRGYRLSFRRVPEA
EGTGNRLSIAVHPAPGLTGEERMTALEAECERLLALGATRVRRQEPASVIDTGHIVMTDL
EGNEFRLE
selected fasta
>hypothetical protein [Azi38]
ATGAGTGATCGCGTCCAGGTGACCGTCGACGCGCACGACCCGCGCGCGCTGTCGTCCTTC
TGGAGTGCCGCATTGGGCTACGTCCACGTCGGCGCGGAGGGCGAGCGCGACACGCGCGCG
GTGCTGGAGGACCCCGAGGGCCGGGGGTACCGGCTGTCGTTCCGGCGGGTGCCGGAGGCC
GAGGGCACCGGGAACCGCCTCAGCATCGCGGTCCACCCGGCCCCCGGGCTGACGGGCGAG
GAGCGGATGACGGCGCTGGAGGCCGAGTGCGAGCGGCTCCTCGCACTCGGGGCGACGCGC
GTACGCCGCCAAGAGCCTGCCTCCGTGATCGACACCGGCCACATAGTGATGACGGACCTC
GAAGGCAACGAGTTCCGTCTTGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit