close all open/close all

CDS information : Azino_00390


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction55,394 / 54,771 / - [in whole cluster]
55,394 / 54,771 / - [in contig]
Locationcomplement(54771..55394) [in whole cluster]
complement(54771..55394) [in contig]
TypeCDS
Length624 bp (207 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Azi39
Geneorf4
Gene (GenBank)azi39
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • transposase

close this sectionSequence

selected fasta
>[Azi39]
MGAPRGRSGSGKRPTFPQPARHRTVVREVVGYAMAHHHRAELVVDALGMTHDRSGPEDGC
LIHSDRGGESTSARFRDRTGTFGPRQSCGRTGSCFDNSPAESFWTLLKEGTGTRTSSDRA
PGRPKGFNFIETFCNRHRLRRPLGKVTQDGTRCLRGPSSLCGRCRSRRQALGGVRASPRV
RGAARTRPPAPSSAPRPSARGPGGPRC
selected fasta
>[Azi39]
GTGGGTGCACCACGAGGCCGTTCCGGGTCCGGCAAGCGTCCGACGTTCCCGCAGCCGGCG
CGGCACCGGACCGTGGTCCGCGAGGTCGTCGGCTACGCGATGGCCCACCATCACCGCGCC
GAACTCGTCGTGGACGCACTCGGCATGACCCACGACCGGAGTGGACCGGAGGACGGCTGC
CTGATCCACAGCGATCGCGGAGGTGAATCCACGTCGGCCCGATTCCGGGACCGCACAGGC
ACGTTCGGACCGCGGCAGAGCTGCGGACGCACCGGGTCGTGCTTCGACAACTCCCCCGCG
GAGAGCTTCTGGACCCTGCTCAAAGAAGGGACCGGCACCCGCACATCATCCGACCGGGCC
CCCGGCCGCCCGAAGGGCTTCAACTTCATCGAGACCTTCTGCAACCGCCACCGCCTGCGC
AGGCCCCTGGGCAAGGTCACTCAAGACGGAACTCGTTGCCTTCGAGGTCCGTCATCACTA
TGTGGCCGGTGTCGATCACGGAGGCAGGCTCTTGGCGGCGTACGCGCGTCGCCCCGAGTG
CGAGGAGCCGCTCGCACTCGGCCTCCAGCGCCGTCATCCGCTCCTCGCCCGTCAGCCCGG
GGGCCGGGTGGACCGCGATGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001584 Integrase, catalytic core (Domain)
 [27-109]  1.1e-09 PF00665
PF00665   rve
IPR012337 Ribonuclease H-like domain (Domain)
 [27-147]  7.19999557654549e-10 SSF53098
SSF53098   RNaseH_fold
SignalP No significant hit
TMHMM No significant hit