close all open/close all

CDS information : Azino_00400


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction56,232 / 55,483 / - [in whole cluster]
56,232 / 55,483 / - [in contig]
Locationcomplement(55483..56232) [in whole cluster]
complement(55483..56232) [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Azi40
Geneorf5
Gene (GenBank)azi40
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • putative short chain dehydrogenase

close this sectionSequence

selected fasta
>[Azi40]
MDRLAGKHALITGGTSGIGLETAREFLAEGATVAITGRSREKLEEAARELGGPLLTIVSD
AGDVPGQAALAARLREEWPKLDILMSNAADITHLPIEAWTEEAFDRLVATNLKSPFFLIR
DLLPLFSRQSSVILVGSVSAYIGHDNAAVYGAAKAGLLSYTRGLTHELKDRGIRVNGLSP
GPTITNAFASLGPERQAALYEELRQTVPLHRLGTATELAKAAVYLASDESGYTAGTVLRV
DGGIGQLAY
selected fasta
>[Azi40]
ATGGACCGACTTGCAGGAAAGCACGCACTGATCACCGGGGGGACGAGCGGCATCGGCCTG
GAAACGGCCCGCGAATTCCTCGCCGAGGGAGCGACCGTGGCCATCACGGGCCGTTCGCGG
GAGAAACTGGAGGAGGCGGCCCGGGAGCTGGGCGGCCCGCTGCTGACCATCGTCAGTGAC
GCCGGCGACGTACCCGGCCAGGCGGCGCTCGCGGCGCGTCTGCGGGAGGAGTGGCCGAAG
CTCGACATCCTGATGAGCAACGCCGCCGACATCACCCACCTCCCCATCGAGGCATGGACC
GAGGAGGCGTTCGACAGGCTCGTAGCGACCAATCTGAAGTCGCCGTTCTTCCTGATCAGG
GACCTGCTGCCGCTCTTCTCGCGGCAGTCCTCGGTCATCCTCGTGGGCTCGGTCTCCGCG
TACATCGGACACGACAACGCGGCCGTCTACGGCGCGGCCAAGGCGGGTCTGCTCTCCTAC
ACGCGAGGGCTGACCCATGAGCTGAAGGACCGGGGCATCCGCGTCAACGGACTGAGCCCG
GGTCCGACGATCACCAATGCGTTCGCGTCCCTCGGCCCCGAGCGCCAGGCCGCCCTCTAC
GAGGAACTCCGGCAGACCGTGCCTCTGCATCGCCTGGGCACCGCCACCGAGCTGGCGAAG
GCGGCGGTCTACCTCGCCTCGGACGAATCCGGCTACACCGCGGGGACCGTGCTGCGCGTC
GACGGAGGCATCGGGCAGCTCGCGTACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [79-90]  6.59999852526375e-05 PR00080 [130-138]  6.59999852526375e-05 PR00080 [150-169]  6.59999852526375e-05 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  6.50000805230168e-30 PR00081 [79-90]  6.50000805230168e-30 PR00081 [124-140]  6.50000805230168e-30 PR00081 [150-169]  6.50000805230168e-30 PR00081 [171-188]  6.50000805230168e-30 PR00081 [208-228]  6.50000805230168e-30 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [1-244]  2.79999999999994e-74 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit