close all open/close all

CDS information : Azino_00410


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction56,996 / 56,247 / - [in whole cluster]
56,996 / 56,247 / - [in contig]
Locationcomplement(56247..56996) [in whole cluster]
complement(56247..56996) [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Azi41
Geneorf6
Gene (GenBank)azi41
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • putative dehydrogenase

close this sectionSequence

selected fasta
>[Azi41]
MEFAGKTALVTGSGAIGGLGHVTAGVLAAGGAGLILTGTDPQRGAQVVEDLRAAGGGSAG
AVRFIAADLSDPASVRQLAEDAGPVDILVNNASVMTFSPTTGQDLASYEAAFAVNVRAPF
LLTALLAEKMAANGGGSIVNVSSTAAGLGMPGMAVYGATKAALESLTRTWAAEFAGSNVR
VNAVAPGPMRTSKVVAAMGPDMGGMGLTTALKRTSDPAEVAHVIAFLASDRASYMTGAVV
AADGGRTAI
selected fasta
>[Azi41]
ATGGAATTCGCAGGCAAGACGGCACTCGTCACCGGATCCGGTGCGATCGGCGGACTCGGG
CACGTCACGGCCGGGGTGCTGGCCGCGGGCGGCGCCGGCCTGATCCTCACCGGCACCGAT
CCGCAGCGCGGCGCCCAGGTCGTGGAAGACCTCCGCGCAGCCGGCGGCGGCTCCGCCGGG
GCGGTGCGTTTCATCGCCGCCGATCTGTCCGACCCGGCGAGCGTGCGGCAGCTGGCCGAG
GACGCCGGCCCCGTCGACATCCTGGTCAACAACGCGAGCGTGATGACGTTCTCCCCGACC
ACCGGACAGGACCTCGCGAGCTACGAGGCCGCCTTCGCCGTCAATGTGCGGGCGCCCTTC
CTGCTCACCGCCCTGCTCGCGGAGAAAATGGCCGCGAACGGCGGCGGCAGCATCGTCAAC
GTCAGTTCCACCGCGGCGGGCCTCGGCATGCCGGGCATGGCCGTCTACGGTGCCACCAAG
GCCGCGCTCGAATCGCTCACCCGCACCTGGGCGGCGGAATTCGCCGGCTCGAACGTGCGG
GTCAACGCCGTCGCCCCGGGCCCGATGCGCACCTCGAAGGTGGTCGCGGCAATGGGCCCG
GACATGGGCGGCATGGGTCTGACCACCGCACTCAAGCGCACCTCCGACCCGGCCGAGGTG
GCCCACGTGATCGCCTTCCTCGCCAGTGACCGGGCCAGTTACATGACCGGCGCGGTCGTG
GCCGCCGACGGTGGCCGCACCGCGATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [83-94]  2.00000075217457e-11 PR00080 [136-144]  2.00000075217457e-11 PR00080 [156-175]  2.00000075217457e-11 PR00080
PR00080   SDRFAMILY
 [1-246]  3.59999643435987e-15 PIRSF000126
PIRSF000126   11-beta-HSD1
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [7-24]  4.39999001237725e-34 PR00081 [83-94]  4.39999001237725e-34 PR00081 [130-146]  4.39999001237725e-34 PR00081 [156-175]  4.39999001237725e-34 PR00081 [177-194]  4.39999001237725e-34 PR00081 [210-230]  4.39999001237725e-34 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-248]  1.9e-71 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [143-171]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-28]  0.608 Signal
Bacteria, Gram-positive   
 [1-24]  0.463 Signal
Eukaryota   
 [1-28]  0.716 Signal
Bacteria, Gram-negative   
TMHMM
 [15-37]  Transmembrane (o-i)
Transmembrane 1