close all open/close all

CDS information : Azino_00420


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction57,114 / 57,713 / + [in whole cluster]
57,114 / 57,713 / + [in contig]
Location57114..57713 [in whole cluster]
57114..57713 [in contig]
TypeCDS
Length600 bp (199 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Azi42
Geneorf7
Gene (GenBank)azi42
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • putative tetR-family transcriptional regulator

close this sectionSequence

selected fasta
>[Azi42]
MARTGRPREFDKERTLERALELFWSRGYGATSIQDLVDALAVERGSLYGAFGDKRRFYLE
AVRLYWEVYERHLTAALDTRPLLPALREILTHPARLDELISDLGVPQGCLIGNTTAELVP
QDSEATQIVTRSYHRFTDIVAAALRRAQADGEVTDTCSPEAQAQLLLYIVQGLSLVSRAG
LDRAAALAAIDTALDGLRA
selected fasta
>[Azi42]
GTGGCACGAACCGGACGCCCCCGCGAGTTCGACAAGGAACGGACGCTGGAGCGCGCACTC
GAACTCTTCTGGTCCCGGGGATACGGGGCGACGTCGATCCAGGACCTGGTCGACGCGCTG
GCGGTCGAACGCGGCAGCCTCTACGGCGCGTTCGGCGACAAGCGCCGCTTCTACCTCGAG
GCCGTCAGGCTCTACTGGGAGGTGTACGAGCGGCACCTGACCGCCGCGCTCGACACCCGC
CCCCTCCTGCCCGCCCTGCGGGAGATCCTGACCCATCCCGCGCGGCTGGACGAACTGATC
TCCGACCTGGGCGTCCCACAGGGCTGCCTGATCGGCAACACGACCGCCGAGCTCGTCCCC
CAGGACAGCGAAGCCACGCAGATCGTCACCCGCTCGTACCACCGGTTCACCGACATCGTC
GCCGCTGCGCTCCGCCGCGCACAGGCCGACGGAGAGGTCACGGACACCTGCTCCCCCGAG
GCCCAGGCACAACTCCTCCTCTACATCGTCCAGGGCCTCTCGCTCGTATCGAGGGCGGGG
CTCGACAGGGCGGCGGCCCTGGCGGCGATCGACACGGCGCTGGACGGACTGCGGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [9-69]  PS50977
PS50977   HTH_TETR_2
 [16-60]  1.4e-10 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [7-80]  6.40000038788486e-15 SSF46689
SSF46689   Homeodomain_like
 [2-67]  1.99999999999999e-18 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [80-198]  6.50000805230168e-23 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [72-198]  4.9e-18 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit