close all open/close all

CDS information : Azino_00430


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction57,868 / 58,323 / + [in whole cluster]
57,868 / 58,323 / + [in contig]
Location57868..58323 [in whole cluster]
57868..58323 [in contig]
TypeCDS
Length456 bp (151 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Azi43
Geneorf8
Gene (GenBank)azi43
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • conserved hypothetical protein

close this sectionSequence

selected fasta
>[Azi43]
MEMTVQLTIDCSDPRTMVAFWAEALGYVPEPAPDGYATWGAYWEATGVPAEELPAGAGDT
AESIVDPAGRGPRVWFQQVPEPKAAKNRWHFDLKAGGGRDVPLDVRARRVRAAVDRLVEA
GATVVKIKDEPRTGLYAAAMQDPEGNEFDVV
selected fasta
>[Azi43]
ATGGAGATGACAGTGCAGCTGACGATCGACTGCTCCGATCCGCGGACAATGGTGGCGTTC
TGGGCGGAGGCCCTGGGCTACGTGCCCGAGCCCGCGCCGGACGGGTACGCGACGTGGGGC
GCTTACTGGGAGGCGACGGGGGTGCCCGCGGAAGAGTTGCCGGCCGGGGCAGGCGACACC
GCGGAGTCGATCGTCGATCCGGCGGGTCGCGGGCCCCGTGTGTGGTTCCAGCAGGTTCCG
GAGCCGAAGGCCGCCAAGAACCGGTGGCACTTCGACCTGAAGGCCGGTGGCGGCCGTGAC
GTCCCGTTGGACGTCCGCGCGCGGCGGGTCAGGGCCGCTGTGGACCGGCTGGTCGAAGCC
GGTGCCACCGTGGTGAAGATCAAGGATGAGCCGCGCACGGGGCTTTACGCCGCGGCCATG
CAGGACCCCGAGGGCAACGAGTTCGACGTCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025870 Glyoxalase-like domain (Domain)
 [9-150]  2.8e-11 PF12681
PF12681   Glyoxalase_2
SignalP
 [1-24]  0.136 Signal
Bacteria, Gram-positive   
TMHMM No significant hit