close all open/close all

CDS information : Azino_00440


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction59,205 / 58,792 / - [in whole cluster]
59,205 / 58,792 / - [in contig]
Locationcomplement(58792..59205) [in whole cluster]
complement(58792..59205) [in contig]
TypeCDS
Length414 bp (137 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Azi44
Geneorf9
Gene (GenBank)azi44
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • putative transcriptional regulator

close this sectionSequence

selected fasta
>[Azi44]
MAKAPRRGPYICGIDAALDVVSGKWKGLILWELDAHRVRRFAELRRGLPGVSEKMLTQHL
REMEEDGLVHREVYAEVPPRVEYSLTEHGRTLNQALGPLGAWGVERMRREGSEAVAVTET
SHEVSVPAGNPVRGCHS
selected fasta
>[Azi44]
ATGGCCAAGGCACCGAGACGCGGGCCCTACATCTGCGGCATCGACGCTGCGCTCGACGTG
GTGAGCGGCAAGTGGAAGGGACTGATCCTCTGGGAACTCGACGCCCATCGCGTACGCCGT
TTCGCTGAGCTCCGTCGCGGTCTGCCGGGGGTGAGCGAGAAGATGCTGACGCAGCACCTG
CGCGAGATGGAGGAAGACGGTCTCGTGCACCGAGAGGTCTATGCCGAGGTGCCGCCGCGG
GTGGAGTACTCCCTGACCGAGCACGGGCGCACGCTCAACCAAGCGCTCGGACCGCTCGGC
GCCTGGGGGGTCGAGCGGATGCGCCGCGAAGGCTCCGAAGCGGTCGCCGTGACCGAGACC
TCACACGAGGTAAGCGTCCCGGCCGGCAACCCTGTGCGTGGGTGCCACTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002577 Helix-turn-helix, HxlR type (Domain)
 [12-111]  PS51118
PS51118   HTH_HXLR
 [20-108]  1.6e-32 PF01638
PF01638   HxlR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [12-101]  9.29999999999998e-19 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-8]  0.173 Signal
Eukaryota   
TMHMM No significant hit