close all open/close all

CDS information : Azino_00450


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction59,338 / 60,198 / + [in whole cluster]
59,338 / 60,198 / + [in contig]
Location59338..60198 [in whole cluster]
59338..60198 [in contig]
TypeCDS
Length861 bp (286 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Azi45
Geneorf10
Gene (GenBank)azi45
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • similar to 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases

close this sectionSequence

selected fasta
>[Azi45]
MIGLGPMGQAMTRTLLTAGHPVTVWNRTAGRADGVVTDGATLAATPSEAVEASDLVILSL
TDYQAMYDILGSATASLAGRTLVNLSSDTPDRSREAATWAAGHDATFLTGGVMVPAPMVG
TEAAHVYYSGRDQVMERHLAALTLLGTPKYLGEDPGLAQMMYQAQLAVFLTTLSGLMHAT
AMLGTAGMKAKEALPELLSSADSIGDILRAGEENPGTALDAGEHPGDLSTVTMMGATSDH
IVETSTSLGLDLALPLAVQAHYRRAIENGHGSDNWTRIIDSIRGPR
selected fasta
>[Azi45]
GTGATCGGGCTCGGCCCGATGGGCCAGGCGATGACCCGCACCCTCCTCACCGCCGGCCAC
CCGGTCACCGTCTGGAACCGCACCGCCGGTCGGGCCGACGGCGTCGTCACCGACGGAGCG
ACGCTCGCGGCGACACCCAGCGAAGCGGTCGAAGCGAGTGACCTCGTGATCCTCAGTCTC
ACCGACTACCAGGCGATGTACGACATCCTCGGCAGCGCCACCGCATCGCTCGCCGGCCGG
ACACTGGTCAACCTGAGCTCTGACACTCCCGACCGTTCACGCGAGGCAGCAACCTGGGCA
GCGGGCCACGACGCCACCTTCCTCACCGGAGGTGTCATGGTCCCCGCGCCGATGGTCGGC
ACGGAGGCAGCCCATGTCTACTACAGCGGCCGCGACCAAGTGATGGAGCGCCACCTGGCG
GCGTTGACACTGCTGGGAACACCAAAGTATCTGGGCGAAGACCCGGGCCTCGCCCAGATG
ATGTATCAAGCCCAGCTCGCGGTGTTCCTCACCACCTTGTCCGGACTCATGCACGCCACC
GCGATGCTGGGCACCGCAGGAATGAAGGCCAAGGAAGCGCTGCCGGAGTTGCTCTCCTCC
GCCGACTCGATCGGCGACATCCTGAGGGCTGGTGAAGAGAACCCCGGCACCGCGCTTGAT
GCCGGAGAACATCCCGGCGACCTCAGCACGGTCACGATGATGGGCGCGACATCCGACCAC
ATCGTCGAGACCAGTACGTCACTCGGCCTCGACCTCGCGCTCCCCCTGGCCGTGCAGGCC
CACTACCGGCGGGCGATCGAGAACGGACACGGCAGCGACAACTGGACCCGCATCATCGAC
AGCATCCGAGGACCGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006115 6-phosphogluconate dehydrogenase, NADP-binding (Domain)
 [1-146]  6.40000000000001e-19 PF03446
PF03446   NAD_binding_2
IPR015815 Hydroxy monocarboxylic acid anion dehydrogenase, HIBADH-type (Family)
 [2-281]  3.29999802154459e-14 PIRSF000103
PIRSF000103   HIBADH
IPR016040 NAD(P)-binding domain (Domain)
 [1-146]  1.1e-26 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit