close all open/close all

CDS information : Azino_00460


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction62,064 / 60,583 / - [in whole cluster]
62,064 / 60,583 / - [in contig]
Locationcomplement(60583..62064) [in whole cluster]
complement(60583..62064) [in contig]
TypeCDS
Length1,482 bp (493 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Azi46
Geneorf11
Gene (GenBank)azi46
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • hypothetical protein

close this sectionSequence

selected fasta
>[Azi46]
MGSIQALAGNKAASAVVQRLAGNDETAKPADEQAKPEAKKKSRTGLNIRERIAGALERAN
KHLDVLDTFVLRGMVPANAEMNWKSSQNADTHFSEQVGASAAAASAEMGLTDGVTAVNNV
IDATKAYKESKQNPTGPSSHAPRKKYPSKMLDAIQNTATDASDFIGVARNALHAEGLVTA
ASVAEAGSGMVGAVAGVKSVRAARRFGLTTRKYQNVKKIDVPAPVQEPEINRLHKAEVDS
HWALAQAYVALERAHDGDDEGLADRLGAALDQTGAAFTSIEKAADDVKKAQDTVALNTAR
DYALAKQRNKLWKQGVGAVGDGVRSAGGAVAIAAAATGTLASNPAGWALAATAAGLLLSV
TAYKAGRAGKKRYDGARHPERWAPPTEEGEQTTAEPASRQDALKEALKFWKKAEHSKRDA
MARTLYGLAAGPDVPAGKGTSPELRTSARELLVALKSGPGNLHMTEEAWAASLNDPADAE
KWHKEIANQLASS
selected fasta
>[Azi46]
ATGGGGTCCATACAGGCGCTCGCCGGCAACAAGGCCGCGTCCGCCGTCGTCCAGCGTCTC
GCGGGGAACGACGAGACGGCGAAGCCCGCCGACGAGCAGGCCAAGCCGGAAGCGAAGAAG
AAGTCCCGTACCGGGCTGAACATCCGGGAGCGGATCGCCGGCGCGCTGGAGCGGGCCAAC
AAGCACCTCGACGTCCTCGACACCTTCGTCCTGCGCGGCATGGTCCCGGCCAACGCGGAG
ATGAACTGGAAGTCGTCCCAGAACGCCGACACGCACTTTTCGGAGCAGGTCGGCGCGTCC
GCCGCAGCGGCCAGTGCCGAGATGGGGCTCACCGACGGGGTCACGGCGGTCAACAACGTC
ATCGACGCCACCAAGGCGTACAAGGAGTCCAAGCAGAACCCGACGGGTCCCTCCTCCCAT
GCCCCGCGCAAGAAGTATCCCTCCAAGATGCTCGACGCGATCCAGAACACGGCGACCGAC
GCCTCCGACTTCATCGGCGTCGCCAGGAACGCTCTGCACGCGGAGGGCCTCGTGACGGCG
GCGAGCGTCGCCGAGGCCGGGAGCGGGATGGTCGGCGCCGTCGCGGGCGTCAAGAGCGTC
CGTGCGGCGCGCCGGTTCGGGCTGACGACGCGCAAGTACCAGAACGTCAAGAAGATCGAC
GTGCCCGCGCCGGTGCAGGAGCCCGAGATCAACCGGCTCCACAAGGCGGAGGTGGACAGC
CACTGGGCGCTCGCGCAGGCGTATGTCGCGCTGGAGCGTGCCCATGACGGCGACGACGAG
GGCCTCGCGGACCGGCTGGGCGCCGCCCTGGACCAGACCGGTGCGGCCTTCACGAGCATC
GAGAAGGCCGCCGACGACGTCAAGAAGGCACAGGACACCGTCGCCCTCAACACCGCCCGG
GACTACGCGCTGGCGAAGCAGCGCAACAAGCTCTGGAAGCAGGGGGTCGGCGCGGTCGGG
GACGGCGTGAGGTCGGCCGGCGGCGCGGTGGCGATCGCAGCGGCTGCCACGGGGACGCTG
GCGAGCAACCCGGCCGGCTGGGCGCTGGCCGCGACAGCTGCGGGGCTCCTGCTCTCGGTC
ACCGCGTACAAGGCCGGGCGCGCCGGCAAGAAGCGTTACGACGGCGCCCGCCACCCCGAG
CGCTGGGCCCCGCCCACGGAGGAGGGCGAGCAGACGACAGCCGAGCCCGCCTCCCGCCAG
GACGCCCTCAAGGAAGCGCTGAAGTTCTGGAAGAAGGCCGAACACAGCAAGCGCGACGCC
ATGGCGCGCACCCTCTACGGCCTCGCCGCGGGCCCCGATGTCCCGGCCGGCAAGGGCACC
TCGCCCGAACTGCGCACCTCGGCCCGGGAACTGCTCGTCGCGCTGAAGTCGGGCCCCGGG
AACCTGCACATGACGGAGGAGGCGTGGGCGGCATCCCTGAACGACCCCGCCGACGCCGAG
AAGTGGCACAAGGAGATCGCCAACCAGCTTGCTTCGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit