close all open/close all
Azino_00460 Azino_00460   last last

CDS information : Azino_00470


close this sectionLocation

Organism
StrainNRRL 2485 (=NBRC 13928)
Entry nameAzinomycin B
Contig
Start / Stop / Direction63,538 / 62,942 / - [in whole cluster]
63,538 / 62,942 / - [in contig]
Locationcomplement(62942..63538) [in whole cluster]
complement(62942..63538) [in contig]
TypeCDS
Length597 bp (198 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Azi47
Geneorf12
Gene (GenBank)azi47
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in azinomycin B biosynthesis.
Note (GenBank)
  • putative two-component system response regulator

close this sectionSequence

selected fasta
>[Azi47]
MLEAAGFEMCAQVADAEGLLAAVEEHRPDIAVVDVRMPPGFTDEGVRAALVIRRQYPRTA
VLLLSQYVEERYAADLLAANTSGVGYLLKQRVADVEEFAEAVRRVAAGGTALDPQVVAQL
LVRRHSDPLDRLTPREREVLELMAGGRSNSGIAAELVVSESAVAKHINSIFTKLDLPRAD
ADHRRVLAVLRFLGVATV
selected fasta
>[Azi47]
GTGCTGGAGGCGGCCGGCTTCGAGATGTGCGCGCAGGTCGCCGACGCGGAAGGGCTGCTG
GCGGCCGTCGAGGAGCACCGGCCCGACATCGCCGTGGTCGACGTGCGCATGCCGCCCGGC
TTCACCGACGAGGGAGTACGCGCCGCGCTGGTGATCCGCCGCCAGTACCCGCGTACCGCC
GTGCTCCTGCTGTCGCAGTACGTGGAGGAGCGGTACGCCGCCGATCTGCTCGCCGCCAAC
ACCTCGGGCGTCGGCTATCTGCTCAAGCAACGCGTCGCCGACGTGGAGGAGTTCGCCGAG
GCGGTACGCCGGGTGGCGGCCGGCGGCACCGCGCTCGACCCGCAGGTCGTCGCGCAGCTG
CTGGTGCGCCGGCACAGCGATCCGCTCGACCGGCTCACACCGCGCGAGCGGGAGGTGCTG
GAGCTGATGGCGGGCGGCCGGTCCAACTCCGGCATAGCCGCCGAGCTGGTGGTGAGCGAG
AGCGCTGTCGCCAAGCACATCAACAGCATTTTCACCAAGCTCGACCTGCCCAGGGCCGAC
GCCGACCACCGCCGCGTCCTGGCGGTGCTGCGCTTCCTGGGCGTTGCGACCGTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [125-196]  18.769 PS50043
PS50043   HTH_LUXR_2
 [132-146]  5e-10 PR00038 [146-162]  5e-10 PR00038 [162-174]  5e-10 PR00038
PR00038   HTHLUXR
 [130-176]  2.4e-13 PF00196
PF00196   GerE
 [129-192]  9.6e-13 SM00421
SM00421   helix_turn_helix, Lux Regulon
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [1-90]  2.8e-10 PF00072
PF00072   Response_reg
 [1-65]  11.59 PS50110
PS50110   RESPONSE_REGULATORY
IPR011006 CheY-like superfamily (Domain)
 [1-130]  3.6e-12 SSF52172
SSF52172   CheY-like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [109-177]  1.4e-20 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [110-175]  2.8e-14 SSF46894
SSF46894   C-terminal effector domain of the bipartite response regulators
SignalP
 [1-16]  0.149 Signal
Eukaryota   
TMHMM No significant hit
Azino_00460 Azino_00460   last last