close all open/close all
first first   Balhi_00020 Balhi_00020

CDS information : Balhi_00010


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction759 / 1 / - [in whole cluster]
759 / 1 / - [in contig]
Locationcomplement(1..759) [in whole cluster]
complement(1..759) [in contig]
TypeCDS
Length759 bp (252 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase(fragment)
Product (GenBank)putative two-component system sensor kinase
GenevanS
vnlS
Gene (GenBank)vanS
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in balhimycin biosynthesis and resistance.
Note (GenBank)
Reference
ACC
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)
[27420548] The VanRS Homologous Two-Component System VnlRSAb of the Glycopeptide Producer Amycolatopsis balhimycina Activates Transcription of the vanHAXSc Genes in Streptomyces coelicolor, but not in A. balhimycina. (Microb Drug Resist. , 2016)
Related Reference
ACC
Q9X942
PmId
[15130128] Characterization of an inducible vancomycin resistance system in Streptomyces coelicolor reveals a novel gene (vanK) required for drug resistance. (Mol Microbiol. , 2004)
[16420361] The vancomycin resistance VanRS two-component signal transduction system of Streptomyces coelicolor. (Mol Microbiol. , 2006)
[20383152] A vancomycin photoprobe identifies the histidine kinase VanSsc as a vancomycin receptor. (Nat Chem Biol. , 2010)
[23836175] In vivo studies suggest that induction of VanS-dependent vancomycin resistance requires binding of the drug to D-Ala-D-Ala termini in the peptidoglycan cell wall. (Antimicrob Agents Chemother. , 2013)

close this sectionSequence

selected fasta
>putative two-component system histidine kinase(fragment) [putative two-component system sensor kinase]
MDRAAGMSVRLKLTLSYACFLVLAGVLLLASVWLFLLRDVPDVLAKPPPGGVLERSVLVR
NFLPAAGSVLFFLLLFGLLGGWILAGRMLAPLTRITDAARMAANGSLSHRIRLEGTEDEF
RELADAFDAMLARLEAHVAAQRRFAANASHELRTPLAITQALLEVARNDPAKDPLLVFDR
LHAVNARAIDLTEALLVLSRADQRAFTREPVDLSLLVEEAIETLLPIAEKRRVVIIASGH
ISRVVGSATLLLQ
selected fasta
>putative two-component system histidine kinase(fragment) [putative two-component system sensor kinase]
GTGGACAGAGCGGCCGGGATGAGCGTCCGCCTCAAACTCACCCTCAGCTACGCCTGCTTC
CTCGTGCTCGCCGGTGTACTGCTGCTCGCTTCCGTGTGGCTGTTCCTGCTGCGTGATGTC
CCCGACGTGCTGGCCAAACCGCCCCCCGGCGGGGTGCTGGAGCGGTCCGTCCTGGTGCGC
AACTTCCTGCCGGCCGCGGGCTCAGTGCTGTTCTTCCTGCTGCTGTTCGGCCTGCTGGGC
GGCTGGATCCTCGCCGGCCGCATGCTCGCCCCGCTGACCCGGATCACCGACGCCGCGCGC
ATGGCCGCGAACGGGTCGCTCTCCCACCGGATCCGGCTGGAAGGCACCGAAGACGAGTTC
CGCGAACTCGCCGATGCCTTCGACGCCATGCTCGCCCGGCTCGAAGCCCACGTCGCCGCG
CAGCGGAGGTTCGCCGCGAACGCCTCGCACGAGCTGCGCACCCCGCTGGCGATCACGCAG
GCGCTTCTCGAAGTGGCCCGCAACGATCCGGCGAAAGACCCGCTGCTGGTCTTCGACCGC
CTCCACGCGGTGAACGCCCGGGCGATCGACCTCACCGAGGCGCTGCTGGTGCTCAGCCGC
GCCGATCAGCGCGCGTTCACCCGGGAACCGGTCGACCTGTCCCTGCTTGTGGAAGAGGCC
ATCGAAACGCTGCTCCCGATCGCCGAGAAACGCCGTGTCGTCATCATCGCCTCCGGTCAC
ATCAGCCGGGTGGTGGGGTCGGCGACGCTGCTGCTGCAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003660 HAMP linker domain (Domain)
 [69-135]  1.5e-16 PF00672
PF00672   HAMP
 [86-139]  PS50885
PS50885   HAMP
 [86-139]  7.60000011115812e-14 SM00304
SM00304   HAMP
IPR003661 Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain (Domain)
 [140-204]  1.89999859865864e-10 SM00388
SM00388   HisKA
 [141-203]  5.3e-08 PF00512
PF00512   HisKA
IPR009082 Signal transduction histidine kinase, homodimeric (Domain)
 [122-206]  2.89999717862184e-13 SSF47384
SSF47384   His_kin_homodim
SignalP No significant hit
TMHMM
 [13-35]  Transmembrane (i-o) [62-84]  Transmembrane (o-i)
Transmembrane 2   
first first   Balhi_00020 Balhi_00020