close all open/close all

CDS information : Balhi_00020


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction1,447 / 770 / - [in whole cluster]
1,447 / 770 / - [in contig]
Locationcomplement(770..1447) [in whole cluster]
complement(770..1447) [in contig]
TypeCDS
Length678 bp (225 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative two-component system response regulator
Product (GenBank)putative two-component system response regulator
GenevanR
vnlR
Gene (GenBank)vanR
EC number
Keyword
Note
  • This ORF is not involved in balhimycin biosynthesis and resistance.
Note (GenBank)
Reference
ACC
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)
[27420548] The VanRS Homologous Two-Component System VnlRSAb of the Glycopeptide Producer Amycolatopsis balhimycina Activates Transcription of the vanHAXSc Genes in Streptomyces coelicolor, but not in A. balhimycina. (Microb Drug Resist. , 2016)
Related Reference
ACC
Q8CJW1
PmId
[15130128] Characterization of an inducible vancomycin resistance system in Streptomyces coelicolor reveals a novel gene (vanK) required for drug resistance. (Mol Microbiol. , 2004)
[16420361] The vancomycin resistance VanRS two-component signal transduction system of Streptomyces coelicolor. (Mol Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative two-component system response regulator [putative two-component system response regulator]
MRVLIVEDEPYLAEAIRDGLRLEAIAADTAGNGDTALELLSLNTYDIAVLDRDIPGPSGD
EIAKRIVASGSGLPILMLTAADRLDDKITGFELGADDYLTKPFELRELVLRLRALDRRRA
HNRPPVLEIAGLRLNPFRREVYRDDRYIALTRKQFAVLEVLVSADGGVVSAEELLERAWD
KNADPFTNAVRITVSALRKRLGEPWIITTVAGVGYRIGAAPGAGR
selected fasta
>putative two-component system response regulator [putative two-component system response regulator]
ATGCGCGTGCTGATCGTCGAGGACGAGCCCTATCTGGCCGAAGCCATCCGCGACGGCCTG
CGTTTGGAAGCGATCGCGGCGGACACCGCGGGCAACGGCGACACCGCTCTCGAACTGCTG
AGCCTCAACACCTACGACATCGCCGTCCTCGACCGGGATATTCCCGGACCCAGCGGGGAC
GAGATCGCCAAACGGATCGTCGCTTCCGGCAGCGGCCTGCCGATCCTCATGCTCACCGCC
GCCGACCGGCTCGACGACAAGATCACCGGGTTCGAGCTCGGTGCCGACGACTACCTCACG
AAGCCGTTCGAACTGCGGGAGCTCGTGCTCAGGCTGCGGGCGCTCGATCGCCGGCGTGCC
CACAACCGGCCGCCGGTACTGGAAATCGCCGGCCTGCGGCTGAACCCGTTCCGCCGCGAG
GTCTACCGCGACGACCGCTACATCGCGCTGACCAGGAAGCAGTTCGCCGTGCTCGAAGTC
CTCGTTTCCGCCGACGGCGGTGTCGTCAGCGCCGAAGAGCTGCTGGAACGGGCCTGGGAC
AAGAACGCCGACCCGTTCACCAACGCTGTGCGCATCACGGTTTCGGCTCTGCGCAAGCGG
CTCGGCGAGCCCTGGATCATCACCACGGTGGCCGGCGTCGGGTACCGCATCGGCGCGGCG
CCCGGCGCCGGGCGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [3-112]  1.2e-22 PF00072
PF00072   Response_reg
 [1-112]  3.1999989904635e-34 SM00448
SM00448   REC
 [2-116]  PS50110
PS50110   RESPONSE_REGULATORY
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [147-217]  1.69999999999999e-17 PF00486
PF00486   Trans_reg_C
 [145-217]  2.60000517657733e-21 SM00862
SM00862   Trans_reg_C
IPR011006 CheY-like superfamily (Domain)
 [1-187]  3.29999077503323e-35 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [124-217]  3e-25 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit