close all open/close all

CDS information : Balhi_00030


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction1,537 / 2,157 / + [in whole cluster]
1,537 / 2,157 / + [in contig]
Location1537..2157 [in whole cluster]
1537..2157 [in contig]
TypeCDS
Length621 bp (206 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
ProductD-alanyl-D-alanine carboxypeptidase
DD-carboxypeptidase
Product (GenBank)putative VanY-type carboxypeptidase
Gene
Gene (GenBank)vanY
EC number3.4.16.4
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)

close this sectionSequence

selected fasta
>D-alanyl-D-alanine carboxypeptidase [putative VanY-type carboxypeptidase]
MTYRESARTTTRRIPGAVVPVARRIRGVLLAGLRAVGTRIARSPGRPVRPQDRAGLGKTH
GAVPAGVTVFDDDVPAVTRLDPALLSALRRAATAAADGGVELCVNSGWRSPEYQSRLLRE
AVAKYGSAAAAARWVATPETSIHVAGKAVDIGPPASASWLSEHGADYGLCRVYRNEPWHF
ELRPEAIEHGCPPLYADPSHDPRLRR
selected fasta
>D-alanyl-D-alanine carboxypeptidase [putative VanY-type carboxypeptidase]
ATGACCTACCGCGAGTCGGCCCGGACGACGACCCGCCGGATTCCCGGCGCCGTCGTGCCG
GTGGCCCGCCGGATTCGCGGGGTCCTTCTCGCCGGCCTGCGCGCCGTCGGCACGAGGATT
GCCCGGTCGCCCGGTCGCCCGGTCCGCCCCCAGGACCGTGCCGGCCTCGGCAAGACCCAC
GGTGCCGTCCCCGCCGGGGTGACGGTCTTCGACGACGACGTCCCGGCTGTGACTCGCCTC
GACCCGGCGCTTCTGAGTGCACTGCGCCGGGCCGCGACCGCGGCCGCCGACGGCGGGGTC
GAACTGTGCGTGAACAGCGGCTGGCGGTCTCCGGAATACCAGAGCCGGCTTCTTCGCGAG
GCGGTGGCGAAATACGGGTCGGCGGCGGCGGCCGCCCGGTGGGTGGCCACCCCGGAGACG
TCGATCCACGTGGCGGGGAAGGCGGTCGACATCGGGCCACCCGCGTCCGCGTCGTGGTTG
TCCGAGCACGGCGCCGATTACGGGTTGTGCCGCGTCTACCGCAACGAACCCTGGCACTTC
GAATTGCGTCCCGAAGCGATCGAGCACGGCTGCCCGCCCCTGTATGCCGACCCGAGTCAC
GACCCGCGGCTGCGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003709 Peptidase M15B/M15C (Domain)
 [79-183]  1.69999999999999e-17 PF02557
PF02557   VanY
IPR009045 Hedgehog signalling/DD-peptidase zinc-binding domain (Domain)
 [76-197]  5.59999989417023e-07 SSF55166
SSF55166   Hedgehog_sig_N
 [72-156]  6.69999999999999e-05 G3DSA:3.30.1380.10
G3DSA:3.30.1380.10   Hedgehog/DD-pept_Zn-bd
SignalP No significant hit
TMHMM No significant hit