close all open/close all

CDS information : Balhi_00050


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction4,106 / 4,981 / + [in whole cluster]
4,106 / 4,981 / + [in contig]
Location4106..4981 [in whole cluster]
4106..4981 [in contig]
TypeCDS
Length876 bp (291 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative prephenate dehydrogenase
Product (GenBank)putative prephenate dehydrogenase
Gene
Gene (GenBank)pdh
EC number1.3.1.-
Keyword
  • Hpg
Note
Note (GenBank)
Reference
ACC
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[20570618] Increased glycopeptide production after overexpression of shikimate pathway genes being part of the balhimycin biosynthetic gene cluster. (Metab Eng. , 2010)
Related Reference
ACC
Q04983
PmId
[7916685] An allosterically insensitive class of cyclohexadienyl dehydrogenase from Zymomonas mobilis. (Eur J Biochem. , 1993)
Family/Domain
FD
IPR003099

close this sectionSequence

selected fasta
>putative prephenate dehydrogenase [putative prephenate dehydrogenase]
MTIEKALVVGTGLIGTSVALALREKGVAVFLSDVDTEAARLAQVLGAGREWAGEGVDLAV
IAVPPHLVGDRLADLQKQGAARVYTDVASVKADPIADAERLGCDLASYVPGHPLAGRERS
GPAAARAELFSGRPWALCPGPETDAEALRRVRELVSLCGATAVVVGAGEHDSAVALVSHA
PHVVASAVAASLASGDDVALGLAGQGLRDVTRIAAGDPLLWRRILSGNTRPVAGVLERIA
ADLAAAASALRSGDLDEVTDLLRRGVDGHGRIPGQRGGSLPGRNPAGSPGR
selected fasta
>putative prephenate dehydrogenase [putative prephenate dehydrogenase]
GTGACCATCGAGAAAGCGCTTGTCGTCGGTACCGGGCTGATCGGCACCTCGGTGGCGCTG
GCCCTCCGGGAGAAGGGCGTCGCGGTCTTCCTCTCCGACGTCGACACCGAGGCCGCCCGG
CTGGCGCAGGTACTCGGCGCCGGGCGGGAGTGGGCGGGAGAAGGTGTGGATCTGGCGGTG
ATCGCCGTGCCGCCGCACCTGGTGGGGGACCGGCTGGCCGACCTGCAGAAGCAAGGTGCG
GCCCGGGTGTACACCGACGTGGCCAGTGTGAAGGCCGATCCGATCGCCGACGCGGAGCGG
CTCGGGTGTGACCTGGCCTCCTATGTGCCGGGCCACCCGCTTGCCGGCCGGGAACGCTCG
GGCCCGGCCGCCGCCCGCGCCGAGCTGTTCTCGGGCCGGCCGTGGGCACTGTGCCCCGGC
CCCGAGACGGACGCGGAAGCCCTGCGACGGGTGCGGGAGCTGGTGTCCCTGTGCGGGGCG
ACGGCCGTCGTCGTGGGTGCGGGCGAGCACGACTCGGCCGTGGCGCTGGTGTCGCACGCC
CCGCACGTGGTGGCGTCGGCGGTGGCGGCCAGCCTGGCGAGCGGCGACGACGTCGCGCTG
GGCCTGGCGGGGCAGGGACTCCGTGATGTGACGCGCATCGCAGCCGGGGATCCCTTGCTG
TGGCGGAGGATTCTCTCCGGGAACACCCGGCCGGTGGCCGGGGTGCTCGAACGGATCGCG
GCCGACCTCGCCGCGGCGGCCTCGGCGTTGCGGTCCGGCGACCTGGACGAGGTGACGGAT
CTGCTGCGGCGCGGCGTGGACGGTCACGGCCGGATCCCTGGTCAGCGCGGCGGATCCCTT
CCCGGCCGCAACCCGGCGGGTTCCCCGGGGCGTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003099 Prephenate dehydrogenase (Domain)
 [18-263]  4.2e-78 PF02153
PF02153   PDH
 [4-280]  PS51176
PS51176   PDH_ADH
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [166-274]  2.30000440726534e-27 SSF48179
SSF48179   6DGDH_C_like
IPR016040 NAD(P)-binding domain (Domain)
 [1-171]  2.7e-26 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit