close all open/close all

CDS information : Balhi_00060


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction5,180 / 7,135 / + [in whole cluster]
5,180 / 7,135 / + [in contig]
Location5180..7135 [in whole cluster]
5180..7135 [in contig]
TypeCDS
Length1,956 bp (651 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
ProductABC transporter ATP-binding/permease protein
Product (GenBank)putative ABC transporter ATP-binding protein
Genetba
Gene (GenBank)abc
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[17823795] The ABC transporter Tba of Amycolatopsis balhimycina is required for efficient export of the glycopeptide antibiotic balhimycin. (Appl Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>ABC transporter ATP-binding/permease protein [putative ABC transporter ATP-binding protein]
MDMVLRFEGVDKSPDDPDPWVTKVRKGTLRRVLAYFRPHVGKVALFCLVAVLESLIVVAT
PLLLKELIDNGIVKNDLGVVILMAGLTAVLAVLGAGLTMVSGYISGRIGEGITYDLRVQA
LGHVRRLPIAFFTRTQTGVLVGRLHTELIMAQQHFTGLLMAATSVVMVVVVLAELIYLSW
IVAIVSLVLIPIFLVPWIRVGRAIQRRSIRLMDANTGLGGLLQERFNVQGAMLSKLFGRP
AEEMAEYEERAGEIRKIGVSLSVWGRMAFVMMALMASLATALVYGIGGGLVLAGAFELGT
LVAIATLLQRLFGPITQLSGMQELAQTVVVSFSRVFELLDLKPLIQERPDAIALKKKVVP
DVEFEHVSFRYPTADEVSLASLEHLRAERERSEVTPDVLRDVSFHAQAGTLTALVGPSGA
GKSTITHLVSRLYDPNGGTVRLGGHDLRDLTFESLREAVGVVSQDAYLFHDTIRENLLYA
RPTATEDELMEACKGAQIRDLIDSLPLGLDTVTGDRGYRMSGGEKQRLAIARLLLKEPSI
VVLDEATAHLDSESEAAVQRALKTALHGRTSLVIAHRLSTIREADQILVIDGGRVRERGT
HDELLAQGGLYAELYHTQFANPAANDPKPEIEDELDDIEPEPVIQHMGYGG
selected fasta
>ABC transporter ATP-binding/permease protein [putative ABC transporter ATP-binding protein]
ATGGACATGGTGTTGCGTTTCGAGGGGGTGGACAAGAGCCCTGACGACCCCGACCCCTGG
GTGACCAAGGTCCGCAAGGGGACGCTGCGCCGCGTGCTCGCCTACTTCCGCCCGCACGTC
GGGAAGGTGGCGCTCTTCTGTCTCGTCGCCGTGCTGGAGTCGCTCATCGTCGTGGCAACT
CCGTTGCTGTTGAAGGAACTCATCGACAACGGCATCGTCAAGAACGATCTCGGGGTCGTG
ATCCTGATGGCCGGCCTCACCGCGGTGCTCGCCGTGCTGGGCGCCGGGCTGACGATGGTG
TCCGGCTACATCTCCGGGCGGATCGGGGAGGGGATCACCTACGATCTCCGGGTCCAGGCG
CTCGGCCACGTCCGGCGGCTGCCGATCGCGTTCTTCACCCGTACCCAGACGGGGGTGCTG
GTCGGCAGGCTGCACACGGAACTGATCATGGCGCAGCAGCATTTCACCGGCTTGCTCATG
GCGGCCACCAGCGTGGTCATGGTCGTGGTGGTGCTGGCCGAGCTGATCTACCTTTCGTGG
ATCGTCGCCATCGTCTCGCTGGTGCTGATTCCGATATTCCTCGTGCCCTGGATTCGCGTG
GGGCGGGCGATCCAGCGGCGCAGTATCCGGCTCATGGACGCGAATACCGGCCTCGGCGGG
CTTCTCCAGGAGCGGTTCAACGTCCAGGGGGCCATGCTCTCCAAGCTCTTCGGCCGTCCC
GCCGAGGAAATGGCCGAGTACGAGGAGCGTGCCGGGGAGATCCGCAAGATCGGCGTGAGC
CTTTCCGTGTGGGGCCGGATGGCCTTCGTCATGATGGCGCTGATGGCCTCGCTCGCCACG
GCCCTCGTCTACGGGATCGGGGGCGGGCTCGTGCTCGCCGGTGCGTTCGAGCTCGGCACG
CTGGTCGCCATCGCCACCCTGCTCCAGCGGCTGTTCGGGCCGATCACCCAGCTGTCCGGG
ATGCAGGAGCTCGCGCAGACGGTCGTGGTGAGCTTTTCCCGGGTCTTCGAGCTGCTCGAC
CTCAAGCCACTGATCCAGGAACGCCCCGACGCGATCGCGCTGAAGAAGAAGGTGGTGCCG
GACGTCGAGTTCGAGCACGTGTCGTTCCGCTACCCCACCGCGGACGAGGTCTCGCTGGCG
TCGCTGGAGCACCTGCGGGCCGAGCGGGAGCGCAGCGAAGTGACGCCGGATGTCCTGCGC
GACGTGAGCTTCCACGCGCAGGCCGGAACCCTCACCGCGCTCGTCGGCCCGTCCGGCGCG
GGGAAGAGCACCATCACCCACCTGGTCTCCCGGCTGTACGACCCGAACGGCGGGACCGTC
CGCCTCGGCGGCCACGATCTGCGCGATCTCACCTTCGAATCGCTCCGCGAAGCGGTCGGG
GTGGTCAGCCAGGACGCCTACCTCTTCCACGACACGATCCGGGAGAACCTCCTCTACGCC
CGCCCGACCGCCACCGAGGACGAGCTGATGGAGGCGTGCAAGGGGGCCCAGATCCGGGAC
CTGATCGACTCCCTCCCGCTCGGGCTGGACACCGTCACGGGCGATCGCGGCTACCGCATG
TCGGGCGGGGAGAAGCAACGACTGGCCATCGCCCGGCTGCTGCTGAAGGAGCCGTCGATC
GTCGTCCTCGACGAAGCCACCGCCCACCTGGACTCCGAGTCGGAGGCCGCCGTCCAGCGG
GCGCTCAAGACGGCCCTGCACGGCCGGACCTCGCTGGTGATCGCCCACCGGTTGTCCACG
ATCCGCGAGGCCGACCAGATCCTCGTGATCGACGGCGGCAGGGTGCGGGAGCGCGGGACA
CACGACGAGCTGCTGGCCCAGGGCGGCCTGTACGCGGAGCTCTACCACACGCAGTTCGCC
AACCCGGCCGCCAACGACCCCAAGCCGGAGATCGAGGACGAGCTCGACGACATCGAGCCC
GAGCCGGTGATCCAACACATGGGCTACGGAGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [45-314]  1.99999999999999e-17 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [362-617]  PS50893
PS50893   ABC_TRANSPORTER_2
 [423-548]  6.70000000000001e-23 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [408-594]  1.49999977583352e-16 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [16-343]  6.4999795054176e-63 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [520-534]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [44-327]  PS50929
PS50929   ABC_TM1F
SignalP No significant hit
TMHMM
 [40-62]  Transmembrane (i-o) [77-99]  Transmembrane (o-i) [155-172]  Transmembrane (i-o) [176-198]  Transmembrane (o-i) [274-296]  Transmembrane (i-o)
Transmembrane 5