close all open/close all

CDS information : Balhi_00070


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction7,138 / 16,635 / + [in whole cluster]
7,138 / 16,635 / + [in contig]
Location7138..16635 [in whole cluster]
7138..16635 [in contig]
TypeCDS
Length9,498 bp (3,165 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)peptide synthetase
Gene
Gene (GenBank)bpsA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)
Related Reference
ACC
O52819
NITE
Chlor_00030
PmId
[10716695] Heterologous expression in Escherichia coli of the first module of the nonribosomal peptide synthetase for chloroeremomycin, a vancomycin-type glycopeptide antibiotic. (Proc Natl Acad Sci U S A. , 2000)

close this sectionPKS/NRPS Module

A1 leucine
2 beta-hydroxytyrosine(Bht)
3 asparagine
A36..428
PCP504..570
C601..893
A1059..1449
PCP1524..1590
E1626..2077
C2089..2381
A2564..2970
PCP3052..3118

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [peptide synthetase]
MNSAARTTPTMLDLFASHVDRTPDAVAVAGGDGVLTYRQLDERAGRLAGRLASRGIRRGD
RVAVVMDRSADLVVALLAVWKAGAAYVPVDAGYPAPRVAFMVADSAAKLVVCSAASRGAV
PAGVESLEPAAAAEEGASDAPAATVRPGDPAYVMYTSGSTGTPKGVTISQGCVAELTMDA
GWAMEPGEAVLMHSPHAFDASLFELWMPLASGVRVVLAEPGSVDARRLREAAAAGVTRVY
LTAGSLRAVAEEAPESFAEFREVLTGGDVVPAHAVERVRTAAPRARFRNMYGPTEATMCA
TWHLLQPGDVVGPVVPIGRPLTGRRVQVLDASLRPVGPGVVGDLYLSGALAEGYFNRAAL
TAERFVADPSAPGQRMYWTGDLAQWTADGELVFAGRADDQVKIRGFRIEPGEIEAALIAQ
PDVHDAVVAAVDGRLIGYVVTEGDADPRVIRERLGAVLPEHLVPAAVLALDALPLTGNGK
VDRSALPAPEFAASAAGRAPSTDAERVLCGLFAEVLGVARAGVDDGFFELGGDSIGAMRL
AARAAKAGLLVTPAQIFEEPTPARLAAVARPVPAGGPVDGPLLTLTAAEEAELALAAPGA
EEIWPLAPLQEGLLFESILDDQGSDIYQVQVILELNGPVDAPRLRAAWDAVVRRHPELRL
SFHRLASGKTVQAVHGDVTPPWRVVDLTGAGDVDAAVAALVAEEQQQRFELATAPLVRLV
LVRIAADRYRLLFVIHHILVDGWSVAVILNDVSEAYEAGEPVPEQRGGATFRDYLAWLDR
QDDDAARAAWRAELAGLDEPALIATSGVETEYDYRATHLTPALHTRLLGFAREHGLTPST
VVHAAWAMVLARLTRRTDVVFGTMVATRPPELAGIESMPGLLMTAVPVRVPLDGGQSVLD
MLTDLHSRQTALKRHQYLGLPEIQKAAGPGATFDTMLVVENYPREYARRYTHLRTIEGTH
YPVTLGITPGDRFKIQLGYWPGQVPDTVAESLLEWFVGAIGALVADPAGLVGRIGMGAAD
VRRWDPPLQAGEPLPALVGRMAARPPDNVAVVDGDGALSYADLWERSLKFAAVLRAHGVR
SEDRVGLVVGRSAWWTVGMLGVLLAGGTFVPVDPAYPAERKEWIFRSANPMLVVCAGATR
GAVPAEFADRLVVIDEVDPAAGSAGDLPRVDPRSAAYVIYTSGSTGTPKGVVVTHAGLGN
LALAHIDRFGVSPSSRVLQFAALGFDTIVSEVMMALLSGATLVVPPERDLPPRASFTDAL
ERWDITHVKAPPSVLGTADVLPSTVETVVAAGELCPPGLVDRLSADRRMINAYGPTETTI
CATMSMPLSPGQHPIPFGKPVPGVRGYLLDSFLRPLPPGVTGELYLAGIGVARGYLGRSA
LTAERFVADPFVPGERMYRTGDLAYWTEQGELVSAGRADDQVKIRGFRVEPREIEFALSG
YPRVTQAAVAVRDDRLVAYVTPGDIDTQAVRAHLASRMPQYMVPAAVVALDALPLTAHGK
IDRRALPDPDFTAGKQAREPATETERVLCELFAGVLGLARVGVDDSFFELGGDSILSMQL
AARARRSGLTFTAADVFDGKTPERIAQLAAESSVPEPGRSPKPDGVGDVAWTPVMWMLGD
GVAGPAFAQWMVVGTPSDLTEKALAAGFAAVVDTHDMLRARVVADEGGRRLVVGERGSVD
VAGAVTRIRADGRSLDEAVADAARAAVTRLDPSAGVMAQAVWVDAGPDQVGRLVVVAHHL
SVDGVSWRILLSDLQAACEAAVAGREPVLEPVGASFKRWAGLLAEWAVSAERAGELAAWK
AILGPGDRPAGAQATSRAAEGAVRSRSWVVPKVETAALAGRAPVAFHCGVNEVLLAGLAG
AVARWRGGDAVLVDVESHGRHPVDGTDLSRTVGWFTSAHPVRLDVAGTDLADVLAGGPAA
GRLLKAVKEQSRAVPGDGLGYGLLRYLNGTTGPVLADLPSPQIGFNYMGRFAAGEKSGVR
AWQPVGDIGSSLEPGMGLPHALEVNAIVQDLPDGPELTLMLEWQDGLLGEDEIDRLGRAW
LDMLSGVARQAADPAAGGHTASDFDLVTLDQAEIEALEAEFAAAGGLAEVLPLSPLQHGL
AFHAGYAGDGVDVYTAQAVLELAGPLDVPLLRKSVRALLDRHANLRAGFRHGADGTAYQV
VPGAVAVPVTLVDVTESADPAAEAAAVAAAERARPFELARPPLLRVMVVVLGPDRHRLVL
TNHHILLDGWSTPLLLDELLTLYRNGAAPAALAPVTPYRDYLAWVRETDREAATEAWRDA
LAGLPEPTLVAADRPVPVEVPEQIWTTLDETFAQALGARARECGVTVSTVLQAVWGMVLA
ALTGRDDVVFGSVVSGRPAELPGIETMVGLFINTVPVRVRMRPQDTFAELVRGLQNEQVA
LLAHHHVGLTDIQQAAGLGRLFDTIIVYENYPRPAEIGDESADADRVRVQGLTAADATHY
PLALAVVPGTDLRLRLEHQPALFTAEQAGAVLERFTLVLEAVVADPRLPLAVVPILSDAE
RRQLQAGNDTALPVPDRTLPELFAAQAAATPEATAVVFEDRSLTYAELDARANQLARWLI
DQGAGPEGLVAVLLPRSLELVVALLAVTKTGGAWLPIDPGYPADRIAFMLDDAGPALVIT
TAVLSASPIGDVLAARSRTVVLDEPAAAGQLAGRDRAPVTDTDRARALDPRHPAYLIYTS
GSTGRPKAVVVTHRNLTNYLLHCGRMYPGLRGRSVLHSSIAFDLTVTATFTPLIVGGEIH
VGALEDLIGVVEAAPSIFLKATPSHLLTLDTASRGSAGSGDLLLGGEQLPADTVVQWRRK
YPNIVVVNEYGPTEATVGCVEYRLEPGQECPPGGVVPIGTPLANMRAFVLDSWLRLVPPG
AVGELYVAGAGLARGYLGRAGLTATRFVADPFGSGERMYRTGDLVQWNPDGQLVFAGRVD
DQVKVRGFRIEPGEIEAALVAQESVGQAVVVARDSEIGTRLIGYVTAAGESGVDEAAVRE
GVAARLPQYMVPAALVVLGALPLTANGKVDRAALPDPDFGARAGGREPVTEAERLLCALF
AEVLGLERAGADDSFFELGGDSILSMRLAARAHREGMSFGAREVFEQRTPAGIAAIVERV
AGDRPVAAVHAVSDVALLDLDQGELDEFKAEFDDDSQPFADPGRY
selected fasta
>non-ribosomal peptide synthetase [peptide synthetase]
ATGAATTCCGCAGCGCGGACCACGCCGACGATGCTGGATCTGTTCGCTTCGCACGTGGAC
CGGACACCTGACGCGGTGGCCGTGGCCGGCGGTGACGGGGTTCTGACGTACCGGCAGCTC
GACGAGCGCGCGGGCCGGTTGGCGGGGCGGCTGGCGAGTCGCGGCATTCGCCGTGGCGAC
CGCGTCGCGGTGGTGATGGACCGTTCGGCGGACCTGGTGGTGGCGCTGCTCGCCGTGTGG
AAGGCGGGGGCGGCGTACGTGCCGGTGGACGCCGGCTACCCCGCGCCGCGAGTGGCCTTC
ATGGTGGCGGACTCGGCGGCCAAGCTCGTGGTGTGCTCGGCCGCGTCGCGCGGCGCCGTA
CCGGCCGGGGTCGAGTCGCTCGAGCCGGCCGCCGCCGCCGAGGAGGGCGCGTCCGACGCG
CCGGCGGCCACGGTGCGACCGGGGGATCCGGCGTACGTGATGTACACGTCCGGCTCGACG
GGCACACCGAAGGGCGTGACCATTTCGCAGGGCTGCGTCGCGGAGCTGACGATGGACGCC
GGGTGGGCGATGGAGCCCGGCGAGGCGGTGCTCATGCATTCGCCGCACGCCTTCGACGCG
TCACTGTTCGAACTCTGGATGCCGCTGGCGTCGGGGGTCCGGGTGGTGCTCGCCGAACCG
GGTTCGGTGGACGCCCGGCGGCTGCGGGAAGCGGCCGCGGCCGGGGTGACGAGGGTGTAC
CTCACCGCGGGGAGCCTGCGCGCGGTGGCGGAGGAGGCGCCGGAATCGTTCGCGGAGTTC
CGTGAGGTGCTGACCGGCGGTGACGTGGTACCCGCGCACGCGGTGGAGCGGGTGCGGACG
GCCGCACCCCGGGCGCGGTTCCGGAACATGTACGGCCCGACGGAAGCGACGATGTGCGCG
ACGTGGCACCTGCTGCAGCCGGGTGACGTGGTGGGCCCGGTCGTGCCGATCGGCCGTCCG
CTGACCGGCCGCCGGGTGCAGGTGCTCGACGCGTCGCTGCGGCCCGTGGGGCCGGGTGTG
GTCGGCGACCTGTACCTCTCCGGGGCGCTGGCGGAGGGCTACTTCAACCGGGCGGCGCTG
ACGGCGGAGCGGTTCGTGGCGGATCCGTCCGCACCGGGGCAGCGGATGTACTGGACCGGG
GACCTCGCCCAGTGGACCGCGGACGGTGAGCTGGTGTTCGCGGGCCGGGCCGACGACCAG
GTGAAGATCCGCGGGTTCCGGATCGAGCCCGGCGAGATCGAGGCCGCGCTGATCGCTCAG
CCGGACGTGCACGACGCCGTCGTGGCGGCGGTCGACGGACGGCTGATCGGGTATGTGGTG
ACCGAGGGGGACGCCGATCCCCGGGTCATCCGCGAACGCCTCGGTGCGGTGCTGCCGGAG
CACCTGGTCCCGGCCGCCGTGCTCGCACTGGACGCACTGCCGCTGACCGGCAACGGCAAG
GTGGACCGGTCCGCGCTGCCGGCGCCCGAGTTCGCGGCGAGTGCCGCCGGGCGGGCACCG
AGCACCGATGCGGAACGTGTCCTCTGTGGACTCTTCGCCGAGGTGCTCGGCGTGGCACGA
GCCGGCGTCGACGACGGTTTCTTCGAGCTGGGCGGGGATTCGATCGGCGCGATGCGGCTG
GCGGCCCGGGCCGCCAAGGCGGGCCTGCTGGTGACGCCCGCCCAGATCTTCGAGGAGCCG
ACCCCCGCCCGGCTGGCCGCCGTGGCGCGGCCGGTCCCGGCCGGCGGGCCCGTCGACGGC
CCCCTGCTCACCCTGACCGCGGCCGAGGAGGCGGAGCTGGCGCTCGCCGCTCCGGGCGCC
GAGGAGATCTGGCCGCTGGCCCCGTTGCAGGAGGGGCTGCTCTTCGAATCGATCCTCGAC
GACCAGGGCTCCGACATCTACCAGGTGCAGGTGATCCTGGAGCTGAACGGGCCGGTGGAC
GCGCCCCGGCTGCGGGCCGCGTGGGACGCGGTCGTCCGGCGGCACCCCGAGCTCCGGCTG
AGCTTCCACCGCCTCGCCTCGGGCAAGACGGTGCAGGCCGTCCACGGGGACGTCACCCCG
CCGTGGCGGGTGGTGGACCTGACGGGTGCCGGCGACGTCGACGCGGCCGTCGCGGCCCTC
GTCGCCGAGGAACAGCAGCAGCGGTTCGAACTCGCCACGGCGCCGCTGGTCCGGCTGGTG
CTGGTCCGGATCGCGGCGGACCGGTACCGCCTGCTGTTCGTCATCCACCACATCCTCGTC
GACGGCTGGTCGGTGGCGGTCATCCTCAACGACGTCTCCGAGGCGTACGAAGCCGGCGAG
CCGGTGCCGGAACAGCGGGGCGGCGCCACCTTCCGGGACTACCTGGCCTGGCTGGACCGG
CAGGACGACGACGCGGCCCGGGCGGCCTGGCGGGCGGAGCTGGCCGGTCTCGACGAGCCC
GCGCTGATCGCGACTTCGGGCGTCGAGACGGAGTACGACTACCGCGCCACGCACCTGACG
CCGGCCCTGCACACCAGGCTGCTGGGGTTCGCCCGCGAGCACGGGCTGACGCCGAGCACG
GTGGTGCACGCCGCCTGGGCGATGGTGCTGGCGCGGCTCACGCGGCGGACCGACGTCGTG
TTCGGCACCATGGTCGCGACCCGTCCCCCGGAACTGGCGGGGATCGAGTCGATGCCGGGC
CTGCTGATGACCGCGGTGCCGGTCCGGGTGCCGCTGGACGGCGGGCAATCGGTCCTGGAC
ATGCTCACCGACCTGCACAGCAGGCAGACGGCCCTCAAACGACACCAGTACCTGGGGCTG
CCGGAGATCCAGAAGGCGGCGGGACCGGGCGCGACGTTCGACACGATGCTGGTGGTCGAG
AACTACCCGCGGGAGTACGCCCGCCGGTACACGCATCTGCGCACGATCGAGGGGACCCAC
TACCCGGTGACCCTGGGCATCACCCCGGGCGACCGGTTCAAGATCCAGCTCGGCTACTGG
CCGGGCCAGGTCCCGGACACCGTCGCCGAGTCGCTGCTGGAGTGGTTCGTCGGCGCCATC
GGCGCGCTGGTCGCCGATCCCGCCGGCCTGGTGGGGCGGATCGGGATGGGCGCGGCCGAC
GTGCGCCGCTGGGACCCGCCGCTGCAGGCGGGGGAGCCGCTGCCGGCCCTGGTGGGGCGG
ATGGCGGCGCGGCCGCCGGACAACGTGGCGGTCGTGGACGGCGACGGTGCGCTGTCCTAT
GCGGACTTGTGGGAGCGGTCGCTGAAGTTCGCGGCCGTCCTGCGGGCCCACGGAGTCCGG
TCCGAGGACCGGGTCGGCCTGGTGGTGGGGCGCTCGGCCTGGTGGACGGTCGGCATGCTG
GGCGTCCTGCTGGCGGGCGGCACGTTCGTGCCGGTGGACCCGGCCTATCCGGCCGAGCGC
AAGGAATGGATCTTCCGGAGCGCGAACCCGATGCTGGTGGTGTGCGCGGGCGCGACACGG
GGGGCGGTGCCCGCGGAGTTCGCGGACCGGCTGGTGGTGATCGACGAGGTCGATCCGGCC
GCGGGCTCGGCGGGGGACCTGCCGCGGGTGGATCCGCGCAGTGCCGCGTACGTGATCTAC
ACGTCGGGGTCGACGGGAACCCCGAAGGGGGTCGTCGTCACCCATGCCGGGCTGGGAAAC
CTGGCGCTGGCGCACATCGACCGGTTCGGGGTGTCCCCGTCGTCACGGGTGCTGCAGTTC
GCGGCGCTCGGGTTCGACACCATCGTCTCCGAGGTGATGATGGCGTTGCTCTCGGGAGCG
ACGCTGGTGGTGCCGCCGGAGCGGGACCTGCCGCCGCGGGCGTCGTTCACCGACGCCCTG
GAACGGTGGGACATCACGCACGTGAAGGCGCCGCCGTCGGTGCTGGGCACGGCCGACGTG
TTGCCGTCGACGGTGGAGACGGTGGTGGCGGCGGGCGAGCTCTGCCCGCCGGGCCTGGTG
GACCGGCTGTCCGCGGACCGGCGGATGATCAACGCCTACGGGCCGACCGAAACCACGATC
TGCGCGACGATGAGCATGCCGTTGTCGCCCGGCCAGCACCCGATCCCGTTCGGCAAGCCG
GTGCCGGGGGTGCGCGGATATCTGCTGGACTCGTTCCTGCGCCCGTTGCCGCCCGGGGTC
ACCGGTGAGCTCTACCTGGCCGGGATCGGCGTGGCCCGCGGCTACCTCGGCCGTTCGGCG
CTGACGGCCGAGCGGTTCGTCGCCGATCCGTTCGTGCCCGGTGAGCGGATGTACCGGACC
GGGGACCTGGCGTACTGGACCGAACAGGGCGAGCTGGTGTCCGCCGGGCGCGCCGACGAC
CAGGTCAAGATCCGCGGCTTCCGTGTCGAACCCCGCGAGATCGAGTTCGCCTTGTCCGGC
TACCCCCGGGTCACCCAGGCCGCGGTCGCCGTCCGCGACGACCGCCTGGTCGCCTACGTG
ACACCAGGCGACATCGACACGCAGGCGGTGCGGGCGCACCTCGCGTCCCGGATGCCCCAG
TACATGGTCCCCGCGGCGGTGGTGGCGCTGGACGCCCTGCCGCTGACGGCGCACGGGAAG
ATCGATCGGCGCGCACTGCCCGACCCCGACTTCACCGCCGGGAAGCAGGCCAGGGAGCCG
GCCACCGAGACCGAGCGGGTGCTGTGCGAGTTGTTCGCCGGCGTGCTCGGCCTGGCGCGG
GTCGGGGTGGACGACAGCTTCTTCGAGCTCGGCGGGGACTCCATCCTCTCGATGCAGCTG
GCGGCGCGGGCGCGGCGGTCGGGGCTGACGTTCACCGCGGCGGACGTCTTCGACGGGAAG
ACGCCCGAGCGGATCGCGCAGCTGGCGGCGGAGTCGTCGGTGCCGGAGCCCGGTCGTTCC
CCGAAACCCGATGGCGTCGGTGACGTCGCGTGGACGCCGGTGATGTGGATGCTGGGAGAC
GGCGTCGCGGGACCGGCGTTCGCGCAGTGGATGGTGGTCGGGACGCCTTCGGACCTGACG
GAGAAGGCGCTGGCGGCGGGCTTTGCGGCCGTGGTGGATACGCACGACATGCTGCGGGCG
CGGGTCGTCGCCGACGAGGGCGGCCGGCGCCTGGTGGTGGGTGAGCGTGGGTCGGTGGAT
GTCGCCGGGGCGGTCACCCGCATCCGCGCCGATGGCCGCTCGCTGGACGAAGCCGTGGCG
GACGCGGCGCGCGCGGCCGTGACCCGGTTGGACCCGTCGGCGGGCGTGATGGCCCAGGCG
GTGTGGGTCGACGCCGGACCGGACCAGGTGGGGCGGCTGGTGGTGGTGGCGCACCACCTG
TCGGTCGATGGCGTGTCGTGGCGGATTCTGCTGTCGGATCTGCAGGCGGCCTGCGAAGCC
GCGGTCGCGGGGCGGGAGCCGGTGCTGGAGCCGGTCGGTGCGTCGTTCAAGCGGTGGGCG
GGCTTGCTGGCCGAGTGGGCGGTTTCCGCGGAGCGGGCCGGTGAGCTGGCCGCGTGGAAG
GCGATTCTCGGACCGGGGGACCGGCCGGCCGGTGCGCAGGCCACGAGCCGGGCCGCGGAA
GGTGCCGTGCGCTCGCGGTCGTGGGTCGTGCCGAAGGTGGAGACGGCGGCGTTGGCAGGC
CGGGCTCCGGTGGCGTTCCACTGCGGGGTGAACGAGGTCCTGCTCGCCGGGCTGGCGGGC
GCGGTCGCGCGGTGGCGCGGCGGGGACGCCGTGCTGGTGGACGTGGAAAGCCATGGCCGC
CACCCGGTGGACGGGACGGACCTGTCCCGGACGGTGGGCTGGTTCACCAGCGCACATCCG
GTACGGCTGGACGTGGCCGGCACCGATCTGGCGGACGTGCTCGCCGGCGGTCCGGCGGCC
GGGCGTTTGCTGAAGGCCGTCAAGGAGCAGTCACGGGCCGTGCCCGGCGACGGGCTCGGA
TACGGCTTGCTGCGGTACCTCAACGGCACGACGGGGCCGGTGCTGGCGGACCTGCCGTCG
CCGCAGATCGGGTTCAACTACATGGGCCGGTTCGCCGCCGGCGAGAAGAGCGGGGTGCGG
GCGTGGCAGCCGGTCGGTGACATCGGCAGTTCGCTGGAACCCGGTATGGGCCTGCCGCAC
GCGCTCGAGGTCAACGCGATCGTCCAGGACCTGCCGGACGGTCCCGAGCTGACGCTCATG
CTGGAATGGCAGGACGGCCTGCTCGGCGAGGACGAGATCGACCGGCTGGGCCGGGCCTGG
CTGGACATGCTGTCCGGGGTGGCCCGCCAGGCGGCTGATCCCGCCGCGGGCGGGCACACC
GCGTCCGACTTCGACCTCGTCACCCTGGACCAGGCGGAGATCGAGGCCCTCGAGGCCGAA
TTCGCGGCCGCCGGCGGACTGGCCGAGGTGCTGCCGCTGTCGCCGCTGCAGCACGGGCTG
GCCTTCCACGCCGGTTACGCCGGCGACGGCGTCGACGTCTACACCGCGCAGGCGGTGCTG
GAGCTGGCCGGCCCGCTGGACGTGCCGCTGCTGCGGAAGTCGGTGCGCGCGCTGCTGGAC
AGGCACGCGAATCTGCGTGCCGGCTTCCGGCACGGCGCCGACGGGACCGCCTACCAGGTG
GTCCCCGGCGCCGTGGCGGTGCCGGTGACCCTGGTGGACGTGACGGAATCGGCGGATCCG
GCGGCCGAGGCGGCGGCGGTGGCCGCGGCCGAACGGGCGCGGCCGTTCGAGCTGGCCCGG
CCCCCGCTGCTGCGGGTCATGGTGGTGGTGCTCGGCCCGGACCGGCACCGGCTGGTGCTG
ACCAACCACCACATCCTGCTCGACGGCTGGTCGACGCCGCTGCTGCTGGACGAACTGCTC
ACGCTTTACCGCAACGGAGCCGCTCCGGCCGCGCTGGCGCCGGTCACCCCGTATCGGGAC
TACCTGGCCTGGGTGCGCGAAACCGACCGGGAGGCGGCTACCGAAGCCTGGCGCGACGCC
CTGGCCGGCTTGCCCGAGCCGACCCTGGTGGCGGCGGACCGGCCGGTCCCGGTCGAGGTG
CCCGAGCAGATCTGGACCACCCTGGACGAGACGTTCGCCCAGGCGCTGGGGGCGCGGGCA
CGCGAGTGCGGTGTCACGGTCAGCACCGTGCTGCAGGCGGTGTGGGGCATGGTGCTGGCG
GCGCTCACCGGACGCGACGACGTGGTGTTCGGGTCGGTGGTGTCCGGGCGCCCGGCCGAG
CTGCCGGGGATCGAGACCATGGTCGGGTTGTTCATCAACACCGTCCCGGTCCGGGTCCGG
ATGCGGCCGCAGGACACCTTCGCCGAACTGGTGCGGGGACTGCAGAACGAGCAGGTGGCG
CTGCTGGCCCACCACCACGTGGGTCTCACCGACATCCAGCAGGCCGCGGGGCTGGGGCGG
CTGTTCGACACCATCATCGTCTACGAGAACTACCCGAGACCGGCCGAGATCGGCGACGAA
TCCGCCGATGCCGATCGGGTCCGGGTGCAGGGACTGACCGCCGCCGATGCCACCCACTAC
CCGCTGGCGCTGGCGGTCGTGCCGGGCACCGACCTGCGGCTGCGGCTGGAGCACCAGCCC
GCGCTGTTCACCGCCGAGCAGGCCGGCGCCGTGCTCGAGCGGTTCACGCTGGTGCTCGAA
GCCGTCGTCGCCGATCCGCGGCTGCCGCTCGCGGTGGTGCCGATCCTGTCCGATGCCGAA
CGGCGACAGCTGCAGGCGGGCAACGACACCGCGCTGCCGGTGCCGGACCGGACGTTGCCG
GAGCTGTTCGCCGCGCAGGCCGCCGCCACCCCGGAGGCGACCGCGGTGGTCTTCGAGGAC
CGGTCGCTGACCTACGCCGAGCTCGACGCGCGCGCCAACCAGCTGGCGCGCTGGCTCATC
GACCAGGGTGCCGGGCCGGAAGGCCTGGTCGCGGTGCTGCTGCCCCGGTCGCTGGAACTG
GTCGTCGCGTTGCTGGCGGTCACCAAGACCGGCGGCGCGTGGCTGCCGATCGATCCGGGC
TATCCGGCCGACCGCATCGCCTTCATGCTCGACGACGCCGGACCGGCGCTGGTGATCACC
ACCGCGGTGCTGTCGGCATCGCCGATCGGTGACGTGCTGGCCGCCCGCTCGAGGACGGTG
GTGCTCGACGAGCCCGCGGCCGCGGGCCAGCTGGCGGGGCGGGACCGCGCGCCGGTCACC
GACACCGACCGCGCTCGAGCGCTGGATCCGCGCCACCCGGCGTACCTCATCTACACCTCG
GGCTCCACCGGTCGCCCCAAGGCCGTGGTCGTCACCCATCGGAACCTGACGAACTACCTG
CTCCACTGTGGACGGATGTACCCGGGTCTGCGGGGGCGGTCGGTGCTGCATTCGTCGATC
GCCTTCGATCTGACGGTCACCGCGACGTTCACCCCGCTCATCGTGGGGGGAGAGATTCAC
GTCGGTGCCCTGGAAGACCTGATCGGGGTGGTGGAGGCCGCACCGTCGATCTTCCTCAAG
GCCACGCCGAGCCATCTGCTGACCTTGGACACCGCTTCCCGGGGCAGTGCCGGTTCGGGT
GACCTCCTGCTCGGCGGCGAACAATTGCCGGCCGACACGGTCGTCCAATGGCGCCGGAAG
TATCCGAACATCGTGGTGGTCAATGAATACGGGCCGACCGAGGCGACCGTCGGGTGCGTC
GAATACCGGCTCGAACCGGGGCAGGAATGCCCGCCGGGCGGTGTGGTGCCGATCGGCACC
CCGCTGGCGAACATGCGGGCGTTCGTGCTGGATTCGTGGCTGCGGCTGGTGCCGCCGGGT
GCGGTGGGCGAGTTGTACGTGGCCGGTGCGGGCCTGGCGCGGGGATACCTGGGCCGGGCA
GGGCTGACGGCGACGCGGTTCGTGGCCGATCCGTTCGGCTCCGGCGAGCGGATGTACCGG
ACCGGGGACCTGGTGCAGTGGAACCCGGACGGACAGCTGGTGTTCGCCGGCCGGGTCGAC
GACCAGGTGAAGGTGCGGGGCTTCCGGATCGAGCCCGGTGAGATCGAGGCCGCCCTGGTG
GCGCAGGAGTCAGTGGGCCAGGCGGTGGTGGTGGCCCGTGACAGCGAGATCGGCACCCGG
CTGATCGGGTACGTGACCGCCGCGGGGGAGTCCGGTGTGGACGAAGCCGCGGTGCGCGAG
GGAGTGGCGGCCCGGTTGCCGCAGTACATGGTGCCGGCGGCGCTGGTGGTACTCGGCGCG
CTGCCGTTGACGGCGAACGGAAAGGTGGACCGGGCGGCGCTGCCGGATCCCGACTTCGGC
GCCCGTGCCGGGGGCCGGGAGCCGGTCACGGAGGCCGAGCGGCTGCTGTGTGCGCTCTTC
GCCGAGGTGCTCGGCCTGGAGCGCGCCGGTGCGGACGACAGTTTCTTCGAGCTGGGTGGG
GATTCCATCCTTTCGATGCGGCTGGCGGCCCGGGCCCACCGCGAGGGAATGTCCTTCGGT
GCGCGCGAGGTGTTCGAGCAGCGCACGCCCGCGGGGATCGCGGCGATCGTGGAACGGGTT
GCGGGCGATCGTCCTGTCGCGGCGGTACACGCCGTGTCCGATGTCGCCCTTCTCGACCTG
GACCAAGGCGAGCTCGACGAATTCAAGGCTGAGTTCGACGACGATTCCCAGCCCTTTGCT
GATCCAGGGAGATATTGA
[1] A36..428
[1] leucine199..299
[1] PCP504..570
[2] C601..893
[2] A1059..1449
[2] beta-hydroxytyrosine(Bht)1226..1321
[2] PCP1524..1590
[2] E1626..2077
[3] C2089..2381
[3] A2564..2970
[3] asparagine2743..2838
[3] PCP3052..3118
[1] A106..1284
[1] leucine595..897
[1] PCP1510..1710
[2] C1801..2679
[2] A3175..4347
[2] beta-hydroxytyrosine(Bht)3676..3963
[2] PCP4570..4770
[2] E4876..6231
[3] C6265..7143
[3] A7690..8910
[3] asparagine8227..8514
[3] PCP9154..9354

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [36-428]  2.39999999999997e-107 PF00501 [1059-1449]  3.19999999999996e-108 PF00501 [2564-2970]  5.99999999999995e-105 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [601-893]  2.8e-61 PF00668 [1626-1905]  1.1e-29 PF00668 [2089-2381]  2.70000000000002e-67 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [529-544]  PS00012 [1549-1564]  PS00012 [3077-3092]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [493-570]  2.50000000000001e-73 G3DSA:1.10.1200.10 [1514-1591]  2.50000000000001e-73 G3DSA:1.10.1200.10 [3043-3120]  2.50000000000001e-73 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [497-571]  1.49999977583352e-16 SSF47336 [1517-1591]  6.59999852526375e-18 SSF47336 [3045-3119]  2.39999798157265e-18 SSF47336
SSF47336   ACP_like
 [504-570]  PS50075 [1524-1590]  PS50075 [3052-3118]  PS50075
PS50075   ACP_DOMAIN
 [507-567]  6.00000000000001e-11 PF00550 [1527-1588]  1.1e-10 PF00550 [3055-3115]  1.3e-10 PF00550
PF00550   PP-binding
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1920-2077]  3.89999999999997e-37 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [36-428]  1e-123 TIGR01733 [1059-1449]  8.90000000000015e-120 TIGR01733 [2564-2970]  2.30000000000004e-123 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [505-573]  2.2999993566538e-07 SM00823 [1525-1593]  6.09999977126211e-11 SM00823 [3053-3121]  1.19999985703101e-06 SM00823
SM00823   PKS_PP
IPR020845 AMP-binding, conserved site (Conserved_site)
 [153-164]  PS00455 [1178-1189]  PS00455 [2696-2707]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit