close all open/close all

CDS information : Balhi_00080


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction16,635 / 28,868 / + [in whole cluster]
16,635 / 28,868 / + [in contig]
Location16635..28868 [in whole cluster]
16635..28868 [in contig]
TypeCDS
Length12,234 bp (4,077 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)peptide synthetase
Gene
Gene (GenBank)bpsB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)

close this sectionPKS/NRPS Module

A4 L-4-hydroxyphenylglycine(Hpg)
5 L-4-hydroxyphenylglycine(Hpg)
6 beta-hydroxytyrosine(Bht)
C7..301
A482..879
PCP957..1023
E1064..1500
C1509..1800
A1981..2375
PCP2458..2524
E2562..3011
C3023..3314
A3498..3887
PCP3974..4040

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [peptide synthetase]
MSQSRIEEIWPLSPLQAGLLFHAVYDGEGPDVYIGHWILDLAGPVDAAGLRAAWETLLAR
HAPLRACFRQRKSGETVQIIARQVELPWREVDLSHLDDPEEAVRELAEQDRTTRFDLAQA
PLLRLTLIRLGADAHRLVVTCHHTIMDGWSLPIVIDELSVLYPAGGDASALPDVPSYREY
LAWLSRQDKERALSAWTAELSGAEEPTLVVPADPGRAPAEPESVEAHLPEHLTRSLAELA
RRHGLTLNTVVQGAWALVLAQLAGRPDVVFGAAVSARPPDLPGVEGMVGLFLNTVPVRVR
LRGSTPVVELLAELQKRQSALIPDQFVGLADIQQAAGPAAVFDTLLVFEKFHHGPAGSDS
AGTFRIHVNQGRVAAHYPLTLVAVPGESMYLKLDYLTELFDRETAFAILERFTGVLRQLT
GAGELTVAGVEVTTAAERALVAGEWGASTSAPPSLPALDLFGHQVAHRRDEPAVVDGDRT
VSYGELAERAERLAGYLNGRGVRRGDRVAVVLDRSPDLIATLLAVWKAGAAYVPVDPAYP
VERRKFMLADSGPAAVVCAEAYRAAVPDTCPEPIVLDDPRTRQAVAESPRLSAGTSADDL
AYVMYTSGSTGTPKGVAVSHGNVAALAGEPGWRVGPGDAVLLHASHAFDISLFEMWVPLL
SGARVVLAGPGAVDGAALAAYVAGGVTAAHLTAGAFRVLADESPEAVAGLREVLTGGDAV
PLAAVERVRGRVRNVRVRHLYGPTEATLCATWWLLEPGDETGSVLPIGRPLAGRRVHVLD
AFLRPVPPGVAGELYVAGAGVAQGYSSRPALTAERFVADPSGSGARMYRTGDLAYWTEQG
ALAFAGRADDQVKIRGYRVEPGEIEVVLAGLPGVGQAVVTPRGEHLIGYVVAEAGHDADP
VRLREQLAGTLPEFMVPAAVLVLDELPLTVNGKVDRRALPEPDFAAKSAGREPVTEAERV
LCGVFADVLGLDHVGVDDSFFELGGDSISSMQVAARARREGISLTPRLVFEHRTPERLAA
LAQEAGATPRAEVVTGVGEIPWTPVMRALGDDAMRPGFAQVRVVVTPAGVNPDALVSALQ
AVLDAHDLLRARVEPDGRLIVPERGAVAAAGLLTRVAAGTGGLDEIAEREVRTATGTLDP
SAGIMARVVWIDAGDAEPGRLAFVAHHLSVDAVSWGILLPDLRAAYDEVISGGTPALEPP
VTSYRQWARRLTARALSESTVAELEKWAAVVEGAEPALPQDTGQHTGQSHSWSTSLSGTE
VRDLVTVLPGAFHCGIQDVLLAGLAGAVARVRGSGAALLVDVEGHGREAADGEDLLRTVG
WFTSVHPVRLELSDVDLAGAADGERPAGQLLKAVKEQIRAVPGDGSGYGLLRHLNPGTGA
RLAELPSAQIGFNYLGRTVLAPEDTAWQPNGGGPLGGGPDMVLAHAVEVSAELQDTPAGP
RLGLAIDTRDFDLATVERLGEAWLEMLTGLAAVARGSGAGGHTPADFALVDLTQRDVAEL
EAAAPGLTDIWPLSPLQEGMLFERAFDEDGVDVYQTQRILDLDGPLDEPRLRAAWNQVLA
RHASLRTGFHQLGSGATVQVVVREADIPWRVADLSHLDAAEAAAEVERLLAEDQGRRFDV
TRPPLLRLLLIRLGADEHRLVVTSHHVLLDGWSTPLVVGEMSDGYAGGRSSSKPPSYQDY
LAWLSRQDAEATRSAWRAELAGADEPTLVDADAGKTLVMPDEHAEWLPEPATRALAGFAR
GHGLTVSTIVLGAWALVLARLAGRTDVVFGSVVSGRPADVPDVERMVGMFINTVPARVRL
DGRRPLLEMLEDLQARQAALTEHQYLGLPEIQKVAGTGAIFDTIVMVENYPHDAAGLGGD
GGVAISSVVTRTGTSYPLTMNVSLGDRLRITVSYRPDRIDDATAAEVARQVVRVLERVVA
EPSLPVGRLGVTSEPTRAAVVERWNSTGEAAAETSVLELFRRQAGASPDAVAVVAGERTL
SYADLDRESDRLAGHLAGIGVGRGDRVGVVMTRGADLFVALLGVWKAGAAQVPVNVDYPA
ERIERMLADVGASVAVCVEATRKAVPDGVEPVVVDLPVIGGVRPEAPPVTVGAHDVAYVM
YTSGSTGVPKAVAVPHGSVAALASDPGWSQGPGDCVLLHASHAFDASLVEIWVPLVSGAR
VLVAEPGTVDAERLREAVSRGVTTVHLTAGAFRAVAEESPDSFIGLREILTGGDAVPLAS
VVRMRQACPDVRVRQLYGPTEITLCATWLVLEPGAATGDVLPIGRPLAGRQAYVLDAFLQ
PVAPNVTGELYLAGAGLAHGYLGNTAATSERFVANPFSGGGRMYRTGDLARWTDQGELVF
AGRADSQVKIRGYRVEPGEVEVALTEVPHVAQAVVVAREGQPGEKRLIAYVTAEAGSALE
SAAVRAHLATRLPEFMVPSVVVVLESFPLTLNGKIDRAALPAPEFAGKAAGREPRTEAER
VLCGLFAEILGLERVGADDGFFELGGDSILSMRLAARARRENFVFGAKQVFEQKTPAGIA
AVAERGGQSRPAGVADGVGEVPWTPVVRALLERDPAGLTRGAMAQWVSVAAPRDLSVTAL
VAGLGAVIDTHDMLRSRIVESEGVEPRLVVAGRGTVDAAALVERVEAGDGDLAEIADRCA
HDTAARLDPVAGVLVRAVWVDAGPGRAGRLVVAAHHLVVDVVSWRTLLPDLQAACEAVVA
GGQPALDPPDVSFRRWSRTLDGEAAIRTGELAVWTEILDGAQSRLGELDPRRDTVSTAGR
RSWTVPREHAGVLVEQVTSAFHCGVHEVLLATLAGAVAGWRGGTAVVVDVEGHGRQPLGE
LDLSRTLGWFTDVHPLRLDVTGVDPAEAVAGGDAAGRLLKQVKENVRAVPDGGLGYGMLR
YLNAETGPVLAALPKAEIGFNYLGRFSAGSGGEAQPWQITGIVGGAAEQDTPLRHVVEID
AVVVDGPDGPEFTLTVTWAGRMLGDAEAESLAQAWLDMLAGLAAHVAAGGPGGHTPSDFP
LTALTQREVAEFEAAVPGLLDIWPLSPLQEGLLFHAADDRGPDVYASMRTLAIDGPLDVA
RFRASWTVLLDRHPALRASFHQLESGEAVQVIARDVPPDWRETDLSGLPESEALAEFDRL
AARMHAERFDLTKAPQLRLHLVRLGDRRYRLIFTSHHIVADGWSLPLILVDVLTAYEAGG
DGRTLPAATSYRDFLAWVDRQDKGAAGQAWRTELAGLDEATHVVPPGSIITPLEPERVAF
ELDDETSKRLVEFTRRHGVTANTLFQGVWALHLARLAGRNDVVFGAAVAGRPPEIPGVES
AVGLFMNMLPVRARLTGAEPVVDMLKDLQERQVAMMAHQHIGLPEIKQLTGPGAAFDTIV
VFENYPPAPPRSDDPDALVIRPVGIPNDTGHYPLSMRASVAAGPVRGEFIYRPDVVDRTE
AGEMVAAILRALEQVVAEPWTPVGQVGLIGPEQRRLVVDEWNRTDVPLAAETLPVLFRRQ
AERSPDAVAVEDGARSLTFGGLLGEVEALARLLVGAGVRREHRVGVLVERSAELAVTMMA
VSFAGGVFVPVDPDYPRERVEFMLANSAPGVMVCTKTTRAAVPAEFAGTVLVLDELPAAD
PDVELPPVAPEDAAYVIYTSGSTGVPKGVLVTHSGLANLGYAHIERMAVTSSSRVLQLSA
TGFDAIVSELYMALLAGATLVLPDAASMPPRVTLGEAIRRAGITHLTVSPSVLASEDDLP
DTLRTVLTGGEALPPALVDRWSPGRRVIQAYGPTETTICSTMSAPLSPGHDQVPLGGPIH
NVRHYVLDAFLQPVPPGVVGELYITGVGLARGYLGRPGLTAERFVASPFAPGERMYRSGD
LFRWTREGQLLFAGRVDAQVKVRGYRVEPAEIEAVLAEHPWVGQVAVSVRRDGPGDKQLV
AYVVPSADAAAENGTLASALRELAAERLPEYMMPAAFVSLEQMPLTPNGKLDHRALQAPD
FAGMSSKRAPRTPMEARLCALFADVLGLDQVGPDDSFFELGGDSITSMQLSARARPTGLE
LTPWQVFDEKTPERLAVIVQELAAEGGTTPAPEPGEGTLVALSPDQMDLLEAGLAGE
selected fasta
>non-ribosomal peptide synthetase [peptide synthetase]
ATGAGCCAGTCGCGGATCGAGGAAATCTGGCCGCTGTCGCCACTGCAGGCCGGTTTGCTC
TTCCACGCGGTTTACGACGGCGAAGGGCCCGACGTCTACATCGGTCACTGGATTCTCGAC
CTGGCCGGACCGGTGGACGCGGCCGGGCTGCGTGCGGCGTGGGAGACGCTGCTGGCCCGG
CACGCCCCGCTCCGGGCGTGTTTCCGGCAGCGCAAGTCGGGCGAGACGGTGCAGATCATC
GCCAGGCAGGTGGAACTGCCGTGGCGGGAGGTCGACCTTTCCCACCTCGACGACCCCGAG
GAGGCCGTTCGCGAGCTGGCCGAGCAGGACCGGACGACGAGGTTCGACCTCGCGCAGGCG
CCGTTGCTGCGGCTGACCCTGATCCGGCTCGGCGCCGACGCGCACCGCCTGGTGGTGACC
TGCCACCACACGATCATGGACGGCTGGTCGCTGCCCATCGTGATCGACGAGCTGTCGGTG
CTGTACCCGGCGGGCGGTGACGCGTCGGCGCTGCCGGACGTGCCGTCCTACCGGGAATAC
CTCGCGTGGCTGAGCCGGCAGGACAAGGAACGCGCGCTGTCGGCGTGGACCGCGGAGCTC
AGCGGCGCCGAGGAACCGACGCTGGTGGTGCCCGCCGATCCGGGGCGGGCACCCGCCGAG
CCGGAGAGCGTCGAGGCCCACCTGCCGGAGCACCTCACGCGCTCGCTGGCCGAGCTGGCC
CGTCGCCACGGGTTGACGTTGAACACCGTGGTGCAGGGCGCCTGGGCGCTGGTGCTGGCG
CAGCTGGCCGGCCGGCCGGACGTGGTGTTCGGGGCGGCGGTGTCGGCGCGCCCGCCGGAC
CTGCCCGGTGTGGAGGGGATGGTGGGGCTGTTCCTCAACACCGTTCCCGTGCGCGTGCGG
TTGCGCGGCTCGACGCCGGTCGTCGAGCTGCTGGCGGAGTTGCAGAAACGGCAGTCGGCG
CTCATTCCCGACCAGTTCGTCGGGCTGGCGGACATCCAGCAGGCGGCGGGTCCCGCCGCG
GTTTTCGACACGCTGCTCGTCTTCGAGAAGTTCCACCACGGGCCCGCCGGATCGGACTCC
GCGGGAACCTTCCGCATTCACGTGAACCAGGGCCGGGTGGCGGCCCACTACCCGCTGACG
CTGGTCGCCGTCCCCGGCGAGTCGATGTACCTCAAGCTCGACTACCTGACGGAGCTCTTC
GACCGGGAAACCGCGTTCGCCATCCTCGAGCGGTTCACCGGGGTGCTGCGGCAGCTGACC
GGCGCGGGCGAGCTCACGGTGGCCGGCGTCGAGGTGACGACCGCGGCCGAGCGGGCCCTG
GTGGCCGGGGAATGGGGTGCCTCGACCTCGGCGCCGCCGAGCCTGCCGGCGCTGGATCTG
TTCGGGCACCAGGTGGCGCACCGCCGCGACGAGCCGGCGGTCGTCGACGGCGATCGGACG
GTGTCGTACGGAGAACTCGCCGAGCGCGCTGAGCGGCTCGCCGGCTACCTGAACGGCCGG
GGAGTCCGGCGCGGAGACCGGGTGGCCGTGGTGCTCGACCGGTCACCCGACCTGATCGCG
ACGCTGCTCGCGGTGTGGAAGGCGGGCGCGGCGTACGTTCCGGTGGACCCCGCCTACCCG
GTGGAACGCAGGAAGTTCATGCTGGCGGACTCCGGGCCCGCGGCGGTGGTGTGCGCGGAA
GCGTACCGGGCCGCCGTGCCGGACACCTGCCCCGAGCCGATCGTCCTGGACGATCCCCGG
ACGCGGCAGGCGGTGGCGGAGAGCCCTCGCCTGTCGGCAGGCACGAGCGCCGACGACCTC
GCCTACGTGATGTACACGTCCGGATCGACCGGGACGCCGAAGGGCGTCGCGGTGTCGCAC
GGCAACGTCGCGGCGCTGGCCGGGGAGCCGGGCTGGCGGGTGGGCCCCGGTGACGCCGTG
CTGCTGCACGCCTCGCACGCCTTCGACATCTCGTTGTTCGAAATGTGGGTGCCGCTGCTG
TCGGGTGCCCGGGTGGTGCTGGCCGGACCGGGCGCGGTGGACGGCGCGGCGCTGGCGGCC
TACGTGGCCGGTGGCGTCACGGCCGCCCACCTGACCGCGGGGGCCTTCCGGGTGCTGGCC
GACGAGTCGCCGGAGGCGGTCGCCGGGCTGCGCGAGGTGCTGACCGGTGGGGACGCGGTG
CCGCTGGCGGCGGTCGAGCGGGTGCGCGGACGTGTCCGGAACGTGCGGGTGCGGCACCTC
TACGGCCCGACCGAGGCCACGCTGTGCGCGACGTGGTGGCTGCTCGAACCCGGCGACGAG
ACGGGATCGGTGCTGCCGATCGGACGTCCGCTCGCCGGGCGGCGCGTCCACGTCCTCGAC
GCGTTCCTGCGGCCCGTGCCGCCGGGCGTGGCGGGCGAGCTGTATGTCGCCGGAGCCGGT
GTGGCGCAGGGCTATTCGAGCCGCCCGGCGCTGACGGCCGAGCGGTTCGTCGCCGATCCC
TCCGGTTCCGGTGCGCGGATGTACCGCACCGGGGACCTGGCGTACTGGACGGAGCAGGGT
GCGCTGGCGTTCGCCGGGCGGGCCGACGACCAGGTGAAGATCCGCGGGTACCGCGTGGAG
CCCGGCGAGATCGAGGTGGTCCTCGCCGGCCTGCCCGGCGTCGGCCAGGCCGTGGTGACC
CCGCGGGGTGAGCACCTGATCGGCTATGTGGTCGCCGAAGCGGGCCACGACGCCGACCCG
GTGCGGCTGCGCGAGCAGCTCGCCGGGACGCTGCCCGAGTTCATGGTGCCGGCCGCGGTG
CTGGTGCTGGACGAGTTGCCGTTGACGGTCAACGGGAAGGTGGACCGGCGGGCACTGCCC
GAACCGGACTTCGCGGCGAAGTCGGCGGGCCGGGAGCCGGTCACCGAGGCCGAACGAGTC
CTTTGTGGAGTGTTTGCCGACGTCCTCGGCCTCGACCACGTCGGCGTCGACGACAGCTTC
TTCGAGCTGGGCGGCGACTCGATCTCGTCGATGCAGGTCGCCGCGCGTGCGCGTCGCGAA
GGGATCTCGCTGACCCCGCGGCTGGTGTTCGAGCACCGGACGCCGGAACGCCTCGCGGCA
CTGGCGCAGGAGGCAGGCGCGACGCCACGCGCCGAGGTCGTCACGGGCGTGGGCGAGATC
CCGTGGACGCCGGTGATGCGTGCCCTCGGGGACGACGCGATGCGCCCCGGCTTCGCGCAG
GTGAGAGTCGTCGTCACCCCGGCGGGGGTGAACCCGGACGCGCTCGTGAGCGCCCTGCAG
GCGGTGCTGGACGCGCACGACCTGCTGCGGGCCCGGGTGGAGCCGGACGGACGGCTGATC
GTGCCCGAGCGCGGCGCGGTGGCCGCGGCCGGCCTGCTCACGCGGGTGGCCGCCGGGACC
GGCGGCCTCGACGAGATCGCCGAGCGCGAGGTCAGGACGGCGACGGGCACGCTGGACCCG
TCGGCGGGAATCATGGCGCGGGTCGTGTGGATCGACGCCGGGGACGCCGAGCCGGGCCGG
TTGGCCTTCGTGGCGCACCACCTCTCGGTCGACGCGGTCTCCTGGGGGATCCTGCTGCCG
GATCTGCGAGCGGCCTACGACGAGGTGATCTCCGGCGGGACCCCGGCCCTCGAACCCCCG
GTGACGTCGTATCGGCAGTGGGCGCGCCGGCTGACCGCGCGGGCGCTCAGCGAAAGCACC
GTGGCCGAACTCGAAAAATGGGCTGCCGTCGTGGAAGGCGCGGAACCGGCACTGCCCCAG
GACACCGGGCAGCACACCGGGCAGTCGCACTCGTGGTCCACGAGCCTGTCCGGCACCGAG
GTGCGAGACCTGGTCACTGTCTTGCCGGGCGCGTTCCACTGCGGGATCCAGGACGTTCTG
CTGGCGGGGCTCGCGGGTGCGGTGGCGCGTGTGCGCGGTTCCGGCGCCGCGCTGCTGGTC
GACGTGGAAGGGCACGGTCGCGAAGCCGCCGACGGCGAGGACCTGTTGCGCACCGTCGGC
TGGTTCACCAGCGTTCACCCGGTCCGTCTCGAACTGTCCGATGTGGACCTCGCGGGCGCG
GCGGACGGCGAGCGGCCTGCCGGGCAGTTGCTGAAGGCCGTGAAGGAGCAGATCCGGGCC
GTGCCCGGCGACGGATCCGGCTACGGGCTGCTGCGCCACCTCAACCCGGGCACCGGGGCG
AGGCTGGCCGAGTTGCCGTCCGCGCAGATCGGCTTCAACTACCTCGGCCGGACTGTCCTC
GCTCCCGAGGACACCGCGTGGCAGCCCAACGGCGGAGGGCCGCTCGGCGGCGGTCCGGAC
ATGGTCCTCGCGCACGCCGTGGAGGTCAGCGCGGAACTCCAGGACACGCCGGCCGGCCCC
CGGCTCGGGCTGGCCATCGACACGCGGGATTTCGACCTCGCCACGGTGGAGCGGCTCGGC
GAGGCCTGGCTGGAGATGCTGACCGGTCTCGCGGCGGTGGCCCGCGGATCCGGCGCGGGC
GGGCACACGCCCGCCGACTTCGCTCTGGTCGACCTGACGCAGCGGGACGTGGCGGAGCTG
GAGGCCGCGGCGCCCGGGCTGACGGACATCTGGCCGTTGTCGCCGCTGCAGGAAGGCATG
CTCTTCGAACGGGCCTTCGACGAGGACGGCGTCGACGTCTACCAGACGCAGCGGATCCTG
GACCTCGACGGGCCGCTCGACGAACCCCGGCTGCGCGCGGCCTGGAACCAGGTCCTCGCC
CGGCACGCCTCGCTGCGGACCGGCTTCCACCAGCTGGGGTCCGGCGCCACGGTGCAGGTC
GTCGTGCGCGAGGCCGACATCCCGTGGCGGGTGGCGGATCTGTCGCACCTCGATGCGGCG
GAGGCGGCCGCGGAGGTCGAGCGGCTGCTCGCCGAGGACCAGGGCCGGCGGTTCGACGTG
ACCCGGCCGCCGCTGCTGCGGCTGCTGCTGATCCGGCTCGGTGCGGACGAGCACCGACTC
GTCGTGACCTCGCACCACGTACTCCTCGACGGCTGGTCGACCCCGCTCGTCGTGGGGGAG
ATGTCGGACGGCTACGCGGGCGGCCGCAGCTCCTCGAAGCCGCCGTCCTACCAGGACTAC
CTGGCGTGGCTGAGCCGTCAGGACGCGGAGGCGACCCGATCGGCGTGGCGGGCCGAGCTC
GCCGGCGCGGACGAACCGACCTTGGTCGACGCCGACGCGGGCAAGACGCTCGTGATGCCG
GACGAGCACGCCGAATGGCTGCCCGAGCCGGCGACGCGGGCACTCGCCGGCTTCGCCCGT
GGCCACGGGCTGACGGTGAGCACGATCGTGCTGGGCGCGTGGGCGCTGGTGCTGGCGCGG
CTGGCCGGCCGGACCGACGTGGTGTTCGGCTCGGTGGTGTCGGGGCGTCCGGCGGACGTG
CCGGATGTCGAGCGCATGGTGGGCATGTTCATCAACACCGTCCCGGCCCGGGTGCGGCTC
GACGGCCGCCGGCCGTTGCTGGAGATGCTCGAAGACCTGCAGGCGCGCCAGGCGGCGTTG
ACCGAGCACCAGTACCTGGGGCTGCCGGAGATCCAGAAGGTGGCGGGGACCGGCGCGATC
TTCGACACGATCGTGATGGTCGAGAACTACCCGCACGACGCCGCCGGTCTCGGCGGCGAC
GGCGGGGTGGCGATCAGCTCGGTCGTCACCCGGACCGGCACCAGCTATCCGCTGACCATG
AACGTCAGCCTCGGGGACCGCCTGCGCATCACCGTGTCCTACCGGCCCGACCGGATCGAC
GACGCGACGGCCGCCGAGGTCGCCAGGCAGGTCGTGCGGGTCCTGGAACGGGTGGTGGCC
GAGCCTTCGCTGCCGGTGGGCCGCCTCGGCGTGACGAGCGAACCGACGCGCGCGGCGGTG
GTGGAACGCTGGAACTCGACGGGCGAAGCGGCCGCCGAGACGTCCGTGCTGGAGCTGTTC
CGGCGGCAGGCAGGTGCCTCGCCGGACGCGGTGGCGGTCGTGGCGGGGGAACGCACCCTG
TCCTACGCCGACCTCGACCGCGAGTCCGACCGGCTGGCCGGGCACCTGGCCGGGATCGGC
GTGGGGCGTGGTGACCGCGTCGGCGTGGTGATGACACGCGGCGCGGACCTGTTCGTCGCC
CTGCTCGGGGTCTGGAAGGCAGGCGCCGCGCAGGTACCGGTGAACGTGGACTACCCCGCG
GAACGGATCGAGCGGATGCTGGCCGACGTCGGCGCGTCGGTCGCGGTCTGCGTGGAAGCG
ACCCGCAAGGCGGTGCCGGACGGGGTCGAGCCGGTGGTCGTGGACCTGCCGGTGATCGGC
GGAGTACGGCCCGAGGCGCCACCGGTCACGGTCGGAGCGCACGACGTGGCCTACGTGATG
TACACGTCCGGCTCGACCGGCGTGCCGAAGGCCGTCGCGGTGCCGCACGGGAGCGTGGCG
GCGCTGGCGAGCGACCCGGGCTGGTCGCAGGGCCCCGGCGATTGCGTGCTGCTGCACGCG
TCGCACGCGTTCGACGCGTCGCTGGTCGAGATCTGGGTGCCGCTGGTCAGCGGAGCCCGC
GTGCTGGTTGCGGAACCGGGCACGGTCGACGCGGAACGGCTGCGCGAAGCGGTCTCCCGC
GGCGTGACCACCGTCCACCTGACGGCCGGTGCCTTCCGTGCGGTGGCCGAGGAATCGCCG
GACTCCTTCATCGGGCTGCGCGAGATCCTGACCGGTGGGGACGCGGTGCCGCTCGCGTCC
GTCGTGCGGATGCGCCAGGCCTGCCCGGACGTCCGGGTCCGGCAGCTGTACGGCCCCACC
GAGATCACCCTCTGCGCCACCTGGCTCGTCCTCGAGCCGGGGGCCGCGACGGGCGACGTC
CTGCCGATCGGCAGGCCGCTGGCCGGCCGGCAGGCCTACGTGCTCGACGCGTTCCTGCAG
CCCGTGGCGCCGAACGTGACCGGCGAGCTCTACCTCGCCGGCGCTGGCCTGGCGCACGGT
TACCTGGGCAACACCGCGGCGACCTCGGAGCGGTTCGTCGCCAACCCGTTCTCCGGCGGC
GGCCGGATGTACCGCACCGGCGACCTGGCTCGCTGGACCGACCAGGGCGAGCTGGTGTTC
GCCGGCCGCGCCGACTCCCAGGTGAAGATCCGCGGCTACCGCGTCGAGCCGGGTGAGGTC
GAGGTGGCGCTGACCGAGGTGCCCCACGTCGCGCAGGCGGTCGTGGTGGCGCGGGAAGGC
CAGCCCGGCGAGAAGCGCCTGATCGCGTACGTGACCGCGGAAGCGGGATCGGCACTGGAA
TCCGCCGCGGTCCGCGCGCACCTCGCGACGCGGCTGCCGGAGTTCATGGTGCCGTCGGTG
GTGGTGGTGCTGGAGAGCTTCCCGTTGACGCTCAACGGGAAGATCGACCGCGCGGCCCTG
CCCGCCCCCGAGTTCGCCGGGAAGGCGGCCGGGCGCGAACCGCGCACGGAGGCCGAGCGG
GTGCTGTGCGGCCTGTTCGCCGAGATCCTCGGGCTGGAGCGGGTCGGCGCCGACGACGGC
TTCTTCGAGCTGGGCGGCGACTCGATCCTCTCGATGCGGCTGGCCGCCCGCGCGCGTCGC
GAGAACTTCGTCTTCGGCGCGAAGCAGGTCTTCGAGCAGAAGACGCCCGCGGGGATCGCG
GCGGTCGCCGAGCGTGGCGGGCAGAGCCGCCCGGCCGGCGTCGCCGACGGCGTCGGCGAG
GTTCCGTGGACGCCGGTGGTGCGGGCACTGCTCGAACGCGATCCCGCCGGGCTGACCCGC
GGTGCCATGGCGCAGTGGGTCAGCGTGGCAGCGCCCCGCGACCTTTCGGTGACCGCGCTG
GTCGCCGGGCTGGGCGCGGTGATCGACACGCACGACATGCTGCGGAGCCGGATCGTCGAG
AGCGAGGGCGTGGAACCCCGGCTGGTCGTGGCCGGGCGGGGCACGGTGGACGCGGCGGCG
CTGGTCGAACGGGTCGAGGCCGGCGACGGTGATCTCGCCGAGATCGCGGACCGGTGCGCC
CACGACACGGCCGCACGCCTGGATCCCGTGGCCGGCGTGCTGGTCCGGGCCGTCTGGGTG
GACGCCGGACCGGGCCGCGCCGGACGGCTCGTGGTGGCCGCGCACCACCTCGTGGTCGAC
GTCGTGTCGTGGCGAACCCTCCTGCCGGACCTGCAGGCGGCCTGTGAAGCCGTGGTCGCG
GGCGGGCAGCCGGCGCTCGATCCGCCGGACGTCTCGTTCCGGCGCTGGTCGCGGACGCTG
GACGGCGAGGCGGCGATCCGGACCGGCGAACTGGCGGTGTGGACGGAGATCCTCGACGGG
GCGCAGTCCCGGCTGGGCGAGCTCGATCCGCGGCGCGACACCGTGTCCACCGCGGGACGC
CGGTCCTGGACCGTGCCCCGGGAACACGCGGGCGTGCTCGTGGAACAGGTCACCTCGGCC
TTCCACTGTGGTGTCCACGAGGTGCTGCTGGCCACCCTGGCGGGCGCCGTGGCGGGCTGG
CGCGGCGGCACGGCCGTCGTGGTGGACGTCGAAGGCCACGGCCGTCAGCCCCTCGGGGAA
CTGGACCTGTCGCGGACACTCGGCTGGTTCACCGACGTCCACCCGCTCCGGCTGGACGTC
ACCGGGGTCGACCCGGCCGAGGCGGTCGCCGGCGGCGACGCGGCGGGCCGGTTGCTGAAG
CAGGTCAAGGAGAACGTGCGAGCCGTGCCCGACGGCGGGCTCGGCTACGGGATGCTGCGG
TACCTCAACGCCGAGACGGGGCCGGTCCTCGCCGCGCTGCCGAAGGCGGAGATCGGGTTC
AACTACCTCGGCCGCTTCTCGGCGGGGTCCGGCGGCGAGGCACAACCCTGGCAGATCACG
GGAATCGTCGGCGGTGCGGCGGAGCAGGACACGCCCTTGCGGCACGTCGTGGAGATCGAC
GCCGTCGTGGTGGACGGCCCGGACGGACCCGAATTCACCCTGACCGTGACCTGGGCCGGG
CGGATGCTCGGCGACGCCGAGGCGGAGTCGCTCGCGCAGGCGTGGCTGGACATGCTGGCC
GGCCTGGCCGCCCACGTGGCCGCCGGTGGCCCCGGGGGGCACACGCCGTCCGACTTCCCG
CTCACCGCGCTGACGCAGCGGGAGGTGGCGGAGTTCGAGGCCGCCGTGCCGGGCCTGCTC
GACATCTGGCCGCTTTCCCCGCTGCAGGAAGGCCTGTTGTTCCACGCCGCCGACGACCGC
GGCCCGGACGTCTACGCGAGCATGCGCACCCTCGCCATCGACGGCCCGCTGGACGTCGCC
CGGTTCCGGGCGTCCTGGACGGTCCTGCTCGACCGGCATCCCGCCCTGCGGGCGAGTTTC
CACCAGCTGGAATCCGGCGAGGCCGTGCAGGTGATCGCCCGGGACGTGCCGCCGGACTGG
CGGGAGACCGACCTGTCCGGGCTGCCCGAGAGCGAAGCGCTCGCGGAGTTCGACCGCCTC
GCGGCGCGGATGCACGCCGAGCGGTTCGACCTGACCAAGGCTCCGCAGCTGCGCCTGCAC
CTGGTGCGCCTCGGTGACCGCAGGTACCGGCTGATCTTCACGTCGCACCACATCGTGGCC
GACGGCTGGTCCCTGCCGCTCATCCTGGTCGACGTGCTGACGGCGTACGAGGCAGGCGGT
GACGGCCGGACGCTGCCGGCCGCGACGTCGTACCGTGACTTCCTCGCCTGGGTCGACCGC
CAGGACAAGGGGGCGGCCGGGCAGGCGTGGCGGACCGAGCTCGCGGGGCTCGACGAGGCG
ACCCACGTCGTGCCGCCGGGCTCGATCATCACGCCCCTGGAGCCCGAACGCGTCGCGTTC
GAACTCGACGACGAGACGAGCAAGCGGCTGGTCGAGTTCACCCGGCGGCACGGCGTCACG
GCGAACACGCTCTTCCAGGGGGTCTGGGCACTGCACCTGGCCCGGCTGGCCGGGCGGAAC
GACGTGGTCTTCGGTGCCGCGGTCGCGGGGCGCCCGCCGGAGATCCCCGGCGTCGAGTCC
GCGGTCGGCCTGTTCATGAACATGCTGCCGGTCCGGGCGCGCCTCACCGGTGCCGAGCCG
GTCGTCGACATGCTGAAGGACCTGCAGGAGCGGCAGGTCGCGATGATGGCGCACCAGCAC
ATCGGGCTGCCCGAGATCAAGCAGCTCACCGGGCCGGGGGCGGCGTTCGACACGATCGTG
GTGTTCGAGAACTACCCGCCCGCGCCGCCGAGGTCCGACGACCCCGACGCGCTCGTCATC
CGCCCGGTGGGGATCCCGAACGACACCGGGCACTACCCGCTGTCCATGCGCGCGTCCGTG
GCGGCGGGCCCCGTCCGCGGTGAGTTCATCTACCGGCCGGACGTGGTCGACCGGACCGAG
GCCGGGGAGATGGTCGCGGCGATCCTCCGCGCGCTCGAGCAGGTGGTGGCCGAGCCGTGG
ACGCCGGTGGGCCAGGTCGGCCTGATCGGCCCGGAGCAGCGCCGTCTGGTCGTGGACGAG
TGGAACCGGACCGACGTGCCGCTGGCGGCGGAGACGCTGCCGGTGTTGTTCCGCAGGCAG
GCGGAGCGGTCACCGGATGCGGTGGCCGTCGAGGACGGGGCGCGGAGCCTGACGTTCGGT
GGGCTGCTCGGCGAGGTGGAAGCGCTGGCCCGGCTGCTCGTGGGGGCGGGCGTGCGGCGC
GAGCACCGGGTGGGCGTCCTGGTCGAGCGCTCGGCCGAGCTGGCGGTGACCATGATGGCC
GTGTCGTTCGCCGGCGGGGTGTTCGTGCCGGTCGACCCCGACTATCCCCGTGAGCGCGTC
GAGTTCATGCTGGCGAACTCGGCACCCGGGGTCATGGTGTGCACGAAGACGACCCGGGCG
GCCGTGCCCGCGGAGTTCGCGGGCACCGTGCTGGTGCTGGACGAGCTGCCCGCCGCGGAC
CCGGACGTCGAGCTGCCGCCGGTGGCACCGGAAGACGCGGCGTACGTGATCTACACGTCC
GGGTCGACGGGGGTGCCCAAGGGCGTCCTGGTGACCCACTCCGGGCTCGCCAATCTGGGG
TACGCGCACATCGAGCGGATGGCGGTGACGTCGTCCTCGCGGGTCCTGCAGTTGTCCGCG
ACCGGCTTCGACGCCATCGTGTCCGAGCTCTACATGGCCTTGCTGGCCGGCGCGACCCTG
GTGCTGCCGGACGCGGCGAGCATGCCGCCCCGGGTGACGCTGGGCGAGGCGATCCGGCGG
GCGGGCATCACGCACCTGACCGTGTCGCCGAGTGTGCTGGCGAGCGAGGACGACCTGCCG
GACACGCTGCGGACCGTGCTGACGGGCGGCGAGGCACTGCCGCCCGCGCTGGTGGACCGC
TGGTCACCGGGCCGCCGGGTGATCCAGGCCTACGGGCCGACCGAGACGACCATCTGCTCG
ACGATGAGTGCCCCGCTGTCCCCGGGGCACGACCAGGTCCCGCTCGGCGGCCCGATCCAC
AACGTGCGGCACTACGTGCTCGACGCGTTCCTGCAGCCGGTGCCGCCCGGCGTGGTCGGC
GAGCTCTACATCACGGGTGTCGGGCTGGCGCGCGGCTACCTCGGGCGTCCCGGCCTGACC
GCGGAACGGTTCGTGGCCAGCCCGTTCGCCCCCGGCGAGCGGATGTACCGCTCGGGCGAC
CTGTTCCGCTGGACCCGGGAAGGCCAGCTGCTCTTCGCGGGCCGTGTCGACGCGCAGGTC
AAGGTGCGGGGGTACCGGGTCGAGCCCGCCGAGATCGAGGCCGTGCTCGCGGAGCACCCG
TGGGTCGGCCAGGTGGCGGTGTCCGTCCGCCGGGACGGCCCGGGCGACAAGCAGCTGGTG
GCTTACGTCGTGCCGTCGGCCGACGCGGCCGCCGAGAACGGCACGCTGGCCTCGGCACTG
CGCGAGCTGGCGGCCGAACGCCTGCCGGAGTACATGATGCCCGCGGCGTTCGTGTCGCTG
GAGCAGATGCCGCTCACCCCGAACGGCAAGCTCGACCACCGGGCGCTGCAAGCCCCCGAC
TTCGCCGGGATGTCCTCGAAGCGGGCCCCCCGCACGCCCATGGAGGCGAGGCTGTGCGCG
CTCTTCGCGGACGTGCTCGGCCTTGACCAGGTGGGGCCCGACGACAGCTTCTTCGAACTC
GGCGGCGACTCGATCACCTCGATGCAGCTGTCGGCCCGGGCTCGGCCGACGGGGCTGGAA
CTGACCCCGTGGCAGGTGTTCGACGAGAAGACGCCGGAACGGCTGGCGGTGATCGTCCAG
GAACTCGCGGCCGAGGGCGGGACCACCCCGGCGCCGGAGCCCGGCGAGGGCACGCTCGTC
GCTCTCTCACCTGACCAGATGGACCTACTCGAGGCCGGGCTGGCCGGCGAATGA
[4] C7..301
[4] A482..879
[4] L-4-hydroxyphenylglycine(Hpg)649..749
[4] PCP957..1023
[4] E1064..1500
[5] C1509..1800
[5] A1981..2375
[5] L-4-hydroxyphenylglycine(Hpg)2145..2245
[5] PCP2458..2524
[5] E2562..3011
[6] C3023..3314
[6] A3498..3887
[6] beta-hydroxytyrosine(Bht)3664..3759
[6] PCP3974..4040
[4] C19..903
[4] A1444..2637
[4] L-4-hydroxyphenylglycine(Hpg)1945..2247
[4] PCP2869..3069
[4] E3190..4500
[5] C4525..5400
[5] A5941..7125
[5] L-4-hydroxyphenylglycine(Hpg)6433..6735
[5] PCP7372..7572
[5] E7684..9033
[6] C9067..9942
[6] A10492..11661
[6] beta-hydroxytyrosine(Bht)10990..11277
[6] PCP11920..12120

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [482-879]  2.09999999999996e-112 PF00501 [1981-2375]  1.9e-103 PF00501 [3498-3887]  1.60000000000002e-107 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [7-301]  2.89999999999999e-63 PF00668 [1064-1332]  1.3e-29 PF00668 [1509-1800]  1.29999999999998e-62 PF00668 [2562-2840]  5.19999999999996e-33 PF00668 [3023-3314]  9.69999999999989e-60 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [982-997]  PS00012 [2483-2498]  PS00012 [3999-4014]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [957-1023]  PS50075 [2458-2524]  PS50075 [3974-4040]  PS50075
PS50075   ACP_DOMAIN
 [947-1024]  1.29999999999998e-76 G3DSA:1.10.1200.10 [2449-2525]  1.29999999999998e-76 G3DSA:1.10.1200.10 [3966-4042]  1.29999999999998e-76 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [950-1024]  1.89999859865865e-19 SSF47336 [2451-2525]  1.20000117458134e-16 SSF47336 [3967-4041]  2.39999798157265e-18 SSF47336
SSF47336   ACP_like
 [960-1021]  2.5e-14 PF00550 [2461-2521]  1.7e-09 PF00550 [3977-4036]  8.1e-11 PF00550
PF00550   PP-binding
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1348-1500]  3.60000000000001e-28 TIGR01720 [2855-3011]  2.50000000000001e-41 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [482-879]  3.99999999999998e-130 TIGR01733 [1981-2375]  1.29999999999998e-118 TIGR01733 [3498-3887]  3.49999999999995e-123 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [958-1026]  5.7999965385478e-13 SM00823 [2459-2527]  7.80000016938413e-06 SM00823 [3975-4043]  1.9000006847787e-07 SM00823
SM00823   PKS_PP
IPR020845 AMP-binding, conserved site (Conserved_site)
 [603-614]  PS00455 [2099-2110]  PS00455 [3616-3627]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit