close all open/close all

CDS information : Balhi_00090


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction28,888 / 34,464 / + [in whole cluster]
28,888 / 34,464 / + [in contig]
Location28888..34464 [in whole cluster]
28888..34464 [in contig]
TypeCDS
Length5,577 bp (1,858 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)peptide synthetase
Gene
Gene (GenBank)bpsC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)
[15651041] The biosynthesis of vancomycin-type glycopeptide antibiotics--a model for oxidative side-chain cross-linking by oxygenases coupled to the action of peptide synthetases. (Chembiochem. , 2005)
[17506888] Phylogenetic analysis of condensation domains in NRPS sheds light on their functional evolution. (BMC Evol Biol. , 2007)
Related Reference
ACC
Q70AZ6
NITE
Teicp2_00210
PmId
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[26549530] Sequential In Vitro Cyclization by Cytochrome P450 Enzymes of Glycopeptide Antibiotic Precursors Bearing the X-Domain from Nonribosomal Peptide Biosynthesis. (Angew Chem Int Ed Engl. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)

close this sectionPKS/NRPS Module

A7 L-3,5-dihydroxyphenylglycine(Dpg)
C15..310
A493..887
PCP969..1036
X1050..1349
TE1622..1836

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [peptide synthetase]
MTVDDTRAKRRSSVEDVWPLSPLQEGMLYHTALDDDGPDTYTVQTVYGIDGPLDPGLLRA
SWQALVDRHAALRACFRYVSGAQMVQVIAREAEVPWRETDLSGLPDDIAEGEVDRLAADE
VAERLRIEAAPLMKLHLIRLGPDRHRLVHTLHHVLVDGWSMPILHRELAAIYAAGGDASG
LPPTVSYRDYLAWLGRQDKEVARAAWRAELAGLDTPTTVAAPDPARVPDIHTAVVELPAE
LTDGLAQFARGHDLTLNTVVQGAWAVVLAQLAGRDDVVFGATASGRPADLPGVEAMVGQL
LNTLPVRVRLDGGRRAAELFARLQRDQSALMAHQHLGLQDVQAVVGPGAVFDTLVIYENF
PRKGLGRAPGGGLSLVPVKRGRNSSHYPFTLITGPGERMPLILDYDRGLFDPAAAESVVG
ALARVLERLVAEPDVLVGRLTLASEAERALVVEGFNATAGPVPGESVLELFARRVAAAPD
AVAITGAAGANLTYAEVDQASNRLAGYLAVRGVGRGDRVGVAMERSPDLLIAFLAIWKAG
AAYVPVDVEYPAERISFVFDDSGVSTVLCTLATSAVAPGNAIVLDAPETRVAVRDCAAPE
IRPHADDLAYVMYTSGSTGLPKGVAIPHGAVAGLAGDAGWQIGPGDGVLMHATHVFDPSL
YAMWVPLVSGARVLLTEPGVLDAAGVRQAVHRGATFVHLTAGTFRALAETAPECFEGLVE
IGTGGDVVPLQSVENLRRAQPGLRVRNTYGPTETTLCATWLPIEPGEVLGRELPIGHPMT
NRRIYLLDAFLRPVPPGVAGELYIAGTGLAHGYLKSPGLTAGRFVACPFAAGERMYRTGD
RARWTRDGEVVFLGRADDQVKIRGYRVELGEVEAALAAQPGVVEAVVTAREDQPGEKRLV
GYFVSDGGDAGPVEIRRQLALVLPDYLVPIAVVALPGLPVTPNGKVDRRALPAPDLAGHS
PEKAPENETEKVLCALFAEILSIDQVGVDDTFHDLGGSSALAMRLVARIREELGADLPIR
QLFSSPTPAGLARALAAKSRPALEAAQRPDRVPVTARQLRAWLLADPGGETAGLHTSVAL
RLHGRVDVPALAAALGDVAARHEILRTTFPGDAQSVHQHVHDALAVELTPVGVTEEDLPG
LLAERRDLLFDLTRDVPWRCDLFALSDNEHVLHLQVHRILADDDSLDVFFRDLAAAYGAR
REGRVPERAPLALQFADYALWEQRLLTDENEPGSLINEQVAFWRDNLAGLDGETVLPFDR
PRPAVPSRRAGTVALRLEAGPHARLTEAAEPPGADTLEMVHAALAMLLAKLGAGHDVVIG
TALPRDEELFDLEPMIGPFTRALALRTDVSGDPTFLEVVARVQEAGQATGEHLDLPFERI
VELLDLPASLARHPVFQVGLQVDEEDIDGWAAAELPALRTAVEPGGTAAMELDLAVKLTE
RFDDDDNAGGLEGALHYATDLFDEATAESVARRLVRVLEQVAEDPGRRISDLDVFLDDFE
RGRPPIAPARWAGAVPPVVAELAGDGPLGALLLDEQLRPVAPGAVGDLYVTGPAVDAGTA
TLATVPCPFGDEGHRMLHTGLLARKTPAKTLVVVGERRRSSASVKTGDFEILLPLRAGGD
RPPLFCVHASGGLSWNYEPLLRYLPPNQPVYGVQARGLARTEPLPGSVEEMAADYLEQIR
AVQPAGPYHLLGWSLGGRIAQAMARLLEADGERLGLLALLDAYPVYMGRKTTGAASEEAA
LEQRNQQDLDLAGQLVKGVAARSRLEAVMRNLWKVGPRHTRSPFAGDVLLFVATVDRPAH
LPVPVAKASWKEFTSGAVEAHEIPSNHYDMVQSAALGQIGAIVAEKLRSRPEGERTQR
selected fasta
>non-ribosomal peptide synthetase [peptide synthetase]
GTGACCGTTGACGACACTCGCGCGAAGCGCCGCTCCAGCGTCGAGGACGTCTGGCCTCTT
TCGCCGCTGCAGGAGGGAATGCTCTATCACACCGCCCTCGACGACGACGGGCCGGACACC
TACACGGTGCAGACCGTCTACGGCATCGACGGCCCGCTGGACCCGGGGCTCTTGCGGGCG
TCGTGGCAGGCGCTCGTGGACCGGCACGCCGCGCTGCGGGCCTGTTTCCGGTACGTCTCC
GGGGCGCAGATGGTGCAGGTCATCGCGCGGGAGGCCGAGGTTCCCTGGCGCGAGACGGAC
CTTTCCGGGCTGCCGGACGACATCGCCGAGGGCGAGGTTGACCGGCTGGCGGCGGACGAG
GTGGCCGAGCGGCTGCGCATCGAGGCCGCGCCGCTGATGAAGCTGCACCTGATCCGGCTC
GGCCCGGACCGCCACCGGCTCGTGCACACGCTGCACCACGTGCTGGTGGACGGCTGGTCG
ATGCCGATCCTGCACCGGGAGCTCGCCGCGATCTACGCGGCGGGCGGGGACGCGTCCGGC
CTCCCGCCCACCGTCTCCTACCGGGACTACCTCGCCTGGCTGGGCCGGCAGGACAAGGAG
GTGGCGCGGGCGGCCTGGCGGGCCGAGCTCGCCGGGCTGGACACGCCGACCACGGTCGCC
GCGCCCGATCCGGCCCGCGTCCCGGACATCCACACGGCGGTGGTCGAGCTGCCGGCGGAG
CTGACGGACGGCTTGGCGCAGTTCGCGCGTGGCCACGACCTCACGCTGAACACCGTCGTG
CAGGGCGCGTGGGCCGTCGTGCTGGCCCAGCTCGCGGGCCGCGACGACGTCGTGTTCGGC
GCGACCGCCTCCGGGCGGCCCGCGGACCTGCCCGGGGTGGAGGCGATGGTCGGCCAGCTG
CTCAACACCCTGCCGGTGCGGGTCCGGCTCGACGGCGGGCGCCGCGCGGCCGAGCTGTTC
GCCCGGCTGCAGCGCGACCAGTCGGCACTCATGGCCCACCAGCACCTCGGCCTGCAGGAC
GTGCAGGCCGTCGTCGGACCCGGAGCGGTCTTCGACACGCTCGTCATCTACGAGAACTTC
CCCCGCAAGGGACTCGGCCGGGCACCGGGCGGTGGCCTGAGCCTGGTCCCGGTGAAGCGC
GGGCGGAACTCCTCGCACTACCCGTTCACGCTGATCACCGGACCCGGCGAGCGGATGCCG
CTGATCCTCGACTACGACCGGGGCCTGTTCGACCCCGCGGCCGCCGAATCGGTCGTCGGC
GCGCTGGCCAGGGTGCTGGAGCGGCTGGTCGCCGAGCCCGACGTCCTCGTCGGCAGGCTG
ACGCTCGCGAGCGAGGCCGAACGCGCGCTGGTGGTGGAGGGCTTCAACGCCACCGCGGGC
CCGGTGCCGGGGGAGTCCGTCCTCGAGCTGTTCGCCCGGCGGGTGGCCGCCGCGCCGGAC
GCGGTGGCGATCACCGGCGCCGCCGGCGCGAACCTGACCTACGCCGAGGTCGACCAGGCG
TCGAACCGGCTGGCGGGCTACCTCGCCGTCCGGGGCGTGGGCCGTGGCGACCGCGTCGGG
GTGGCCATGGAACGGTCGCCGGATCTGCTGATCGCGTTCCTGGCGATCTGGAAGGCGGGT
GCCGCCTACGTTCCGGTGGACGTCGAGTACCCGGCCGAGCGGATCTCGTTCGTCTTCGAC
GACTCCGGCGTCTCGACCGTCCTGTGCACCCTGGCCACCAGCGCGGTCGCGCCGGGCAAC
GCGATCGTGCTCGACGCGCCCGAAACACGCGTGGCCGTGCGGGACTGCGCCGCGCCGGAA
ATCCGGCCGCACGCGGACGACCTGGCGTACGTCATGTACACCTCCGGCTCCACCGGCCTG
CCGAAGGGCGTGGCCATCCCGCACGGGGCCGTGGCCGGCCTGGCGGGCGACGCGGGCTGG
CAGATCGGTCCCGGCGACGGCGTGCTGATGCACGCGACGCACGTCTTCGACCCTTCGCTC
TACGCGATGTGGGTGCCGCTCGTCTCGGGCGCCCGGGTCCTGCTCACCGAGCCGGGGGTG
CTGGACGCGGCCGGGGTACGGCAGGCCGTGCACCGGGGCGCGACCTTCGTCCACCTCACC
GCCGGCACCTTCCGCGCGCTGGCGGAGACGGCACCGGAGTGCTTCGAAGGCCTGGTCGAG
ATCGGGACCGGCGGCGACGTGGTTCCGCTGCAGTCGGTGGAGAACCTGCGGCGGGCCCAG
CCCGGCCTGCGGGTGCGCAACACCTACGGGCCGACCGAGACCACCCTGTGCGCGACGTGG
CTGCCGATCGAGCCCGGTGAGGTGCTCGGCCGGGAGCTGCCGATCGGCCATCCGATGACC
AACCGCCGGATCTACCTCCTCGACGCCTTCCTGCGCCCGGTTCCGCCGGGCGTGGCCGGC
GAGCTGTACATCGCGGGCACGGGCCTGGCCCACGGGTACCTGAAGAGCCCCGGCCTGACG
GCCGGCCGGTTCGTGGCCTGCCCGTTCGCCGCCGGTGAACGCATGTACCGCACCGGCGAC
CGGGCGCGCTGGACCCGCGACGGCGAGGTGGTGTTCCTCGGCCGCGCCGACGACCAGGTG
AAGATCCGCGGCTACCGGGTCGAGCTCGGCGAAGTGGAGGCTGCGCTGGCGGCCCAGCCG
GGCGTGGTCGAGGCCGTCGTCACGGCGCGGGAGGACCAGCCCGGCGAGAAGCGCCTGGTC
GGCTACTTCGTCTCCGACGGCGGCGACGCGGGGCCGGTGGAGATCCGGCGGCAGCTGGCC
CTGGTGCTGCCCGACTACCTGGTCCCCATCGCCGTGGTCGCCCTGCCCGGCCTGCCCGTC
ACCCCCAACGGCAAGGTCGATCGCCGGGCCCTGCCCGCCCCGGATCTCGCGGGACACTCG
CCGGAGAAGGCACCCGAGAACGAGACCGAGAAGGTGCTGTGCGCGCTGTTCGCCGAGATC
CTCAGCATCGACCAGGTGGGGGTCGACGACACCTTCCACGACCTCGGCGGCAGTTCGGCG
CTGGCCATGCGGCTCGTCGCGCGGATCCGTGAGGAGCTCGGCGCGGACCTGCCCATCCGG
CAGCTGTTCTCCTCGCCGACCCCCGCGGGCCTGGCCAGGGCGCTGGCCGCGAAGTCACGC
CCCGCGCTGGAAGCCGCCCAGCGGCCGGACCGGGTGCCCGTCACCGCCCGGCAGCTGCGT
GCCTGGCTGCTGGCCGATCCCGGCGGGGAGACGGCCGGCCTGCACACCTCCGTCGCCCTG
CGCCTGCACGGCCGGGTGGACGTGCCCGCGCTGGCGGCGGCGCTCGGCGACGTCGCGGCC
CGGCACGAGATCCTCCGCACGACCTTCCCGGGTGACGCGCAGAGCGTTCACCAGCACGTC
CACGACGCCTTGGCGGTCGAGCTGACTCCGGTCGGAGTCACCGAGGAAGACCTCCCGGGG
CTGCTCGCCGAGCGGCGTGACCTGCTCTTCGACCTCACCAGGGACGTGCCGTGGCGGTGT
GACCTCTTCGCGCTCTCGGACAACGAGCACGTGCTGCACCTGCAGGTCCACCGGATCCTC
GCCGACGACGACTCGCTCGACGTGTTCTTCCGCGACCTGGCGGCCGCCTATGGTGCGCGC
CGCGAAGGCCGGGTCCCGGAGCGCGCGCCCCTGGCGTTGCAGTTCGCCGACTACGCGCTC
TGGGAGCAGCGCCTGCTCACGGACGAGAACGAGCCGGGCAGCCTGATCAACGAGCAGGTG
GCCTTCTGGCGGGACAACCTGGCCGGCCTCGACGGGGAGACGGTGCTGCCGTTCGACCGC
CCGCGCCCGGCCGTCCCGTCGCGGCGCGCCGGAACGGTCGCGCTGCGGCTGGAGGCCGGC
CCGCACGCCCGGTTGACGGAGGCGGCGGAGCCGCCGGGCGCGGACACGCTCGAGATGGTG
CACGCCGCGCTCGCGATGCTGCTGGCCAAGCTCGGAGCGGGCCACGACGTGGTGATCGGC
ACGGCGCTGCCGCGGGACGAGGAGCTCTTCGACCTCGAGCCGATGATCGGGCCGTTCACC
CGGGCGCTCGCCCTGCGCACCGACGTCTCGGGCGATCCGACCTTCCTCGAGGTCGTCGCC
AGGGTGCAGGAGGCGGGCCAAGCCACGGGCGAGCACCTGGACCTGCCCTTCGAACGGATC
GTCGAGCTGCTCGATCTGCCGGCCTCGCTCGCCCGCCACCCCGTGTTCCAGGTGGGACTT
CAGGTGGACGAGGAGGACATCGACGGATGGGCCGCGGCGGAACTGCCCGCCCTGCGCACC
GCCGTCGAACCCGGCGGGACCGCGGCCATGGAGCTGGACCTCGCGGTCAAGCTCACCGAG
CGCTTCGACGACGACGACAACGCCGGCGGCCTCGAGGGCGCGCTGCACTACGCCACCGAC
CTGTTCGACGAGGCCACGGCGGAGTCGGTGGCCCGGCGGCTGGTCCGCGTCCTCGAGCAG
GTGGCGGAGGATCCCGGGCGGCGGATCAGCGACCTGGATGTCTTCCTGGACGACTTCGAA
CGCGGCCGTCCGCCCATCGCTCCGGCGCGGTGGGCCGGGGCCGTGCCCCCGGTGGTCGCC
GAACTGGCCGGGGACGGCCCGCTCGGCGCGCTCCTGCTCGACGAGCAGCTGCGCCCGGTC
GCTCCCGGAGCCGTCGGCGATCTGTACGTCACCGGCCCGGCCGTGGACGCGGGAACGGCC
ACCCTGGCGACCGTGCCCTGCCCGTTCGGGGACGAGGGGCACCGGATGCTGCACACGGGC
CTGCTCGCCCGCAAAACGCCCGCCAAGACCCTGGTCGTCGTGGGCGAGCGGAGGCGGTCG
AGCGCTTCGGTGAAGACGGGTGACTTCGAGATCCTGCTGCCGCTGCGCGCCGGCGGTGAC
CGCCCGCCCCTGTTCTGCGTCCACGCGAGCGGTGGCCTGAGCTGGAACTACGAGCCGTTG
CTGCGGTACCTCCCGCCGAACCAGCCGGTCTACGGCGTGCAGGCTCGCGGCCTGGCCCGG
ACCGAACCGCTGCCGGGCAGCGTCGAGGAGATGGCGGCCGACTACCTCGAGCAGATCCGT
GCCGTGCAGCCGGCCGGGCCGTACCACCTCCTCGGCTGGTCCCTCGGCGGCCGGATCGCG
CAGGCGATGGCCAGGTTGCTCGAGGCGGACGGGGAGCGGCTCGGCCTGCTCGCCCTGCTC
GACGCCTATCCCGTCTACATGGGACGCAAGACGACCGGCGCCGCGAGCGAAGAAGCGGCT
CTCGAACAGCGGAACCAGCAGGATCTGGACCTCGCGGGGCAACTGGTCAAGGGTGTGGCC
GCCCGGTCGCGCCTCGAGGCGGTCATGCGCAACCTCTGGAAGGTCGGGCCACGGCACACA
CGTTCGCCCTTCGCCGGCGACGTCCTGCTTTTCGTGGCCACTGTGGACCGTCCCGCGCAT
TTGCCCGTCCCAGTGGCGAAGGCCAGCTGGAAGGAATTCACCAGTGGGGCGGTAGAGGCC
CACGAAATCCCGTCCAACCACTACGACATGGTGCAATCCGCGGCGCTGGGCCAGATTGGT
GCCATCGTCGCCGAGAAACTCCGGTCCCGGCCGGAGGGTGAAAGGACACAACGATGA
[7] C15..310
[7] A493..887
[7] L-3,5-dihydroxyphenylglycine(Dpg)657..757
[7] PCP969..1036
[7] X1050..1349
[7] TE1622..1836
[7] C43..930
[7] A1477..2661
[7] L-3,5-dihydroxyphenylglycine(Dpg)1969..2271
[7] PCP2905..3108
[7] X3148..4047
[7] TE4864..5508

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [493-887]  8.49999999999995e-105 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [1622-1836]  7.79999999999999e-37 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [15-310]  6.29999999999998e-65 PF00668 [1050-1349]  5.30000000000001e-49 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [972-1035]  8.9e-14 PF00550
PF00550   PP-binding
 [969-1036]  PS50075
PS50075   ACP_DOMAIN
 [960-1039]  2.5e-26 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [962-1037]  1.20000117458134e-19 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [493-887]  3.60000000000002e-124 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [611-622]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit