close all open/close all

CDS information : Balhi_00120


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction36,007 / 37,203 / + [in whole cluster]
36,007 / 37,203 / + [in contig]
Location36007..37203 [in whole cluster]
36007..37203 [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)P450 monooxygenase
Gene
Gene (GenBank)oxyB
EC number
Keyword
  • 1st cross-linking
  • C-O-D ring
Note
Note (GenBank)
Reference
ACC
PmId
[10390204] Identification and analysis of the balhimycin biosynthetic gene cluster and its use for manipulating glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908. (Antimicrob Agents Chemother. , 1999)
[12404385] The Biosynthesis of Vancomycin-Type Glycopeptide Antibiotics-The Order of the Cyclization Steps This work was supported by the Deutsche Forschungsgemeinschaft (SFB 323) and by a grant of the EU (MEGATOP, QLK3-1999-00650). R. D. S. gratefully acknowledges the support of a Feodor-Lynen Fellowship granted by the Alexander-von-Humboldt Stiftung. We thank Corina Bihlmaier and Volker Pfeifer for help with transformation and Southern hybridization, J. A. Moss (La Jolla (USA)) for critical comments on the manuscript and Prof. Dr. M. E. Maier and Prof. Dr. H.-P. Fiedler (Tubingen) for generous support. (Angew Chem Int Ed Engl. , 2001)
[15651041] The biosynthesis of vancomycin-type glycopeptide antibiotics--a model for oxidative side-chain cross-linking by oxygenases coupled to the action of peptide synthetases. (Chembiochem. , 2005)
[16730832] Genetic analysis of the balhimycin (vancomycin-type) oxygenase genes. (J Biotechnol. , 2006)
[20337711] Genome mining in Amycolatopsis balhimycina for ferredoxins capable of supporting cytochrome P450 enzymes involved in glycopeptide antibiotic biosynthesis. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>cytochrome P450 [P450 monooxygenase]
MNDDDPRPLHIRRQGLDPADELLAAGSLTRVTIGSGADAETHWMATAHALVRQVMGDHQR
FSTRRRWDPRDEIGGTGTFRPRELVGNLMDYDPPEHTRLRQKLTPGFTLRKMQRLQPYIE
QIVNERLDEMARAGSPADLVAFVADKVPGAVLCELIGVPRDDRATFMQLCHAHLDASRSQ
KRRAAAGEAFSRYLLAMIARERKDPGEGLIGAVVAEYGDEATDEELRGFCVQVMLAGDDN
ISGMIGLGVLALLRHPEQIDALRGGEQPAQRAVDELIRYLTVPYGPTPRIAKQDVTVGDQ
VIKAGESVICSLPAANRDPALVPDADRLDVTRDPVPHVAFGHGIHHCLGAALARLELRTV
FTALWRRFPDLRLADPAQETKFRLTTPAYGLTELMVAW
selected fasta
>cytochrome P450 [P450 monooxygenase]
TTGAATGATGACGACCCGCGGCCGCTGCACATTCGCCGGCAGGGCCTGGACCCGGCGGAC
GAGCTGCTCGCCGCCGGATCGCTGACGAGGGTCACCATCGGATCCGGAGCGGATGCCGAG
ACCCATTGGATGGCCACCGCGCACGCCCTCGTCCGGCAGGTGATGGGCGACCACCAGCGG
TTCAGCACCCGGCGCCGCTGGGACCCGCGGGACGAGATCGGCGGGACGGGCACCTTCCGG
CCGCGTGAACTGGTCGGCAACCTGATGGACTACGACCCGCCCGAGCACACGCGGCTGCGC
CAGAAGCTGACCCCCGGGTTCACGCTGCGCAAGATGCAGCGGCTGCAGCCGTACATCGAA
CAGATCGTCAACGAGCGACTCGACGAGATGGCGCGGGCGGGATCGCCCGCGGATCTGGTC
GCGTTCGTCGCCGACAAGGTGCCCGGCGCCGTGCTGTGCGAGCTGATCGGCGTGCCGAGG
GACGACCGGGCCACGTTCATGCAGCTGTGCCACGCGCATCTCGACGCCTCGCGAAGCCAG
AAACGGCGGGCGGCGGCGGGAGAGGCGTTCTCCCGCTACCTGCTGGCGATGATCGCCAGG
GAACGCAAGGACCCGGGCGAGGGGCTCATCGGAGCGGTCGTCGCCGAATACGGCGACGAA
GCCACGGACGAGGAGCTGCGCGGCTTCTGCGTGCAGGTGATGCTGGCTGGCGACGACAAC
ATCTCCGGCATGATCGGGCTCGGCGTGCTGGCGCTGCTGCGGCACCCCGAGCAGATCGAC
GCGTTGCGCGGCGGCGAACAGCCGGCGCAACGAGCCGTCGACGAGCTGATCCGGTACCTG
ACCGTGCCCTACGGCCCGACACCCCGCATCGCGAAGCAGGACGTCACCGTCGGGGACCAG
GTGATCAAGGCGGGCGAGAGCGTCATCTGCTCGCTCCCGGCGGCCAACCGCGACCCCGCC
CTCGTGCCGGACGCGGACCGGCTCGATGTCACGCGCGACCCCGTCCCGCACGTCGCGTTC
GGGCACGGGATCCACCACTGCCTGGGAGCCGCACTGGCCCGCCTCGAACTGCGCACGGTC
TTCACCGCGCTGTGGCGGCGGTTTCCCGACCTGCGGCTCGCGGATCCCGCCCAGGAGACC
AAGTTCCGCCTCACCACCCCCGCTTACGGGCTGACCGAGCTGATGGTCGCCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [5-398]  4.20003460493095e-89 SSF48264
SSF48264   Cytochrome_P450
 [270-368]  1.3e-13 PF00067
PF00067   p450
 [26-398]  6.90000000000007e-93 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [91-102]  1.20000117458134e-52 PR00359 [138-154]  1.20000117458134e-52 PR00359 [155-170]  1.20000117458134e-52 PR00359 [192-214]  1.20000117458134e-52 PR00359 [271-282]  1.20000117458134e-52 PR00359 [289-316]  1.20000117458134e-52 PR00359 [317-332]  1.20000117458134e-52 PR00359 [338-347]  1.20000117458134e-52 PR00359 [347-358]  1.20000117458134e-52 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [340-349]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit